Methyloraptor flagellatus: ABS361_10790 Help Entry ABS361_10790      CDS       T10624                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mflg  Methyloraptor flagellatus Pathway mflg01100   Metabolic pathways mflg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mflg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABS361_10790    00074 Mycolic acid biosynthesis     ABS361_10790   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABS361_10790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  XBY46650 UniProt:  A0AAU7XHT6 LinkDB All DBs Position complement(2369714..2369950) Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVEHLGVDPEKVTENASFIDDLGSDSLDVVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFLEKNAG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgaacgggtgaagaagatcgtggtcgagcacctcggcgtggacccg gagaaggtgaccgagaacgcgagcttcatcgacgatctcggctcggactccctcgacgtc gtcgaactcgtcatggcgttcgaagaggaattcggcgtcgagatcccggacgatgcggcc gagacgatcctcaccgtcggcgacgcggtgaagttcctcgagaagaacgccggctga

DBGET integrated database retrieval system