KEGG   Marinobacter flavimaris: ACGK9W_01145
Entry
ACGK9W_01145      CDS       T10818                                 
Name
(GenBank) homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
mfli  Marinobacter flavimaris
Pathway
mfli00260  Glycine, serine and threonine metabolism
mfli00270  Cysteine and methionine metabolism
mfli00300  Lysine biosynthesis
mfli01100  Metabolic pathways
mfli01110  Biosynthesis of secondary metabolites
mfli01120  Microbial metabolism in diverse environments
mfli01230  Biosynthesis of amino acids
Module
mfli_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mfli00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACGK9W_01145
   00270 Cysteine and methionine metabolism
    ACGK9W_01145
   00300 Lysine biosynthesis
    ACGK9W_01145
Enzymes [BR:mfli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     ACGK9W_01145
SSDB
Motif
Pfam: Homoserine_dh NAD_binding_3 ACT ACT_AHAS_ss ACT_4 ACT_9 GFO_IDH_MocA ACT_7 ACT_6 DXP_reductoisom Sacchrp_dh_NADP Peptidase_S66 DapB_N
Other DBs
NCBI-ProteinID: XKQ61874
LinkDB
Position
205392..206693
AA seq 433 aa
MKDVSVGICGLGTVGGGTFNVLTRNARLIAGRAGCNIRITRVASRRAREDMDLGDVPFST
DIYDVVNDPDVDIVVELIGGYDAAKELVLAAIRNGKHVVTANKALIAVHGNEIFEAAEKA
GVVVAYEAGVAGGIPVIKAVREGMAANRIDWIAGIINGTGNYILTEMRAGREFSEVLKEA
QDLGYAEADPTFDVEGIDAAHKLTILASAGFGVPLQFEKGFTEGISKITPYDIAHAELLG
YRIKHLGIARRRDDGIELRVHPTLVPQSHLIAQVDGVLNAVLVDGDAVGQTMYYGPGAGD
EATGSAVIADIVDVARAVATESNLRVPYLGFSPDAMEDLDVLSMEDIQSAYYLRITALDR
PGVLAKIASILSEHGINIESIMQKESELKDGRIPVIILTHTVQERQINRAIEELEALSDT
DGQVVRIRAENFN
NT seq 1302 nt   +upstreamnt  +downstreamnt
ttgaaagacgtcagtgtcggaatctgcggattgggaaccgtcggcggcggtacctttaat
gtcttgacccgcaacgccaggctgattgccggtcgggccggatgcaatatccggattacc
cgggttgccagtcgccgggcccgcgaggatatggacctcggcgatgtgcccttcagtacc
gacatttacgacgtggtgaacgatcccgacgtggatatcgtggtcgagctcatcggtggt
tacgatgcggctaaagagctggtgctggcggcaatccgcaacggcaagcacgtggttacc
gcgaacaaggccctgattgccgtccacggcaacgaaatcttcgaggcggccgagaaggct
ggtgttgtggtggcttacgaggcgggtgtcgccggcggtatcccggtcatcaaggctgtt
cgtgagggtatggcggcaaaccgcattgactggattgccggcatcatcaacggcaccggg
aactacatcctgaccgaaatgcgtgccggtcgggaattttccgaggttctcaaagaagcc
caggatcttgggtacgctgaagcagaccctacctttgatgtggaaggcattgatgccgcc
cacaagctgaccatactggcatcggccgggtttggcgtgcctctccagttcgagaaaggc
ttcaccgaaggcatttcgaagattacgccttatgacattgctcacgccgaattgctgggt
tatcgcatcaagcacctcggcattgcccgtcgccgcgatgatggcatcgagctgcgtgtg
catccgaccctggtgccccagagtcatctgattgcccaggttgatggtgtcctgaacgcg
gtcctggtggatggcgatgccgttggccagaccatgtattatggtcccggagcaggggat
gaggcaaccgggtcggctgttattgccgatatcgtcgatgtggcccgtgccgtggcgaca
gaaagcaacctccgtgtgccttaccttggcttctcaccagatgccatggaagacctggat
gtgctgtccatggaagacatccagtctgcctactacctgcgcattaccgcactggaccgt
ccgggtgtactggccaagattgcctccatcctgagcgagcatggcatcaatattgagtcg
atcatgcagaaggaatccgagctgaaagacggtcgtattccggtgatcatcctgacccac
accgttcaggaacggcagatcaaccgtgcgattgaagagctggaagccctgtccgatacc
gatggccaggttgtccgcatccgcgctgaaaacttcaactga

DBGET integrated database retrieval system