Miscanthus floridulus: 136453026 Help Entry 136453026         CDS       T10264                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism mflo  Miscanthus floridulus Pathway mflo04145   Phagocytosis mflo04517   IgSF CAM signaling mflo04814   Motor proteins Brite KEGG Orthology (KO) [BR:mflo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     136453026  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     136453026   09142 Cell motility    04814 Motor proteins     136453026  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mflo03037]     136453026    04812 Cytoskeleton proteins [BR:mflo04812]     136453026 Cilium and associated proteins [BR:mflo03037]  Motile cilia and associated proteins   Dynein arm    136453026 Cytoskeleton proteins [BR:mflo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      136453026 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  136453026 NCBI-ProteinID:  XP_066309701 LinkDB All DBs Position 5:110943154..110943928 Genome browser AA seq 93 aa AA seqDB search MLEGKAVVEDTDMPAKMQAQAMSAASRALDRFDVLDCRSIAAHIKKEFDAIHGFGWQCVV GSSFGCFFTHSKGSFIYFRLESLWFLVFKGAAA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggaaaggcggtggtggaggacaccgacatgccggcgaagatgcaggctcaa gcgatgtcggcggcgtccagggccctcgaccgcttcgacgtcctcgactgccggagcatc gcggctcacatcaagaaggagtttgacgcgatccatggcttcggatggcaatgcgtggtt ggctccagcttcggctgcttcttcacgcacagcaaggggagcttcatctacttccgcctc gagtcgctctggttcctcgtcttcaaaggggcggcagcatga

DBGET integrated database retrieval system