Miscanthus floridulus: 136453026 Help Entry 136453026         CDS       T10264                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism mflo  Miscanthus floridulus Pathway mflo04517   IgSF CAM signaling mflo04814   Motor proteins Brite KEGG Orthology (KO) [BR:mflo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     136453026  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     136453026  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mflo03037]     136453026    04812 Cytoskeleton proteins [BR:mflo04812]     136453026 Cilium and associated proteins [BR:mflo03037]  Motile cilia and associated proteins   Dynein arm    136453026 Cytoskeleton proteins [BR:mflo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      136453026 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  136453026 NCBI-ProteinID:  XP_066309701 LinkDB All DBs Position 5:110943154..110943928 Genome browser AA seq 93 aa AA seqDB search MLEGKAVVEDTDMPAKMQAQAMSAASRALDRFDVLDCRSIAAHIKKEFDAIHGFGWQCVV GSSFGCFFTHSKGSFIYFRLESLWFLVFKGAAA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggaaaggcggtggtggaggacaccgacatgccggcgaagatgcaggctcaa gcgatgtcggcggcgtccagggccctcgaccgcttcgacgtcctcgactgccggagcatc gcggctcacatcaagaaggagtttgacgcgatccatggcttcggatggcaatgcgtggtt ggctccagcttcggctgcttcttcacgcacagcaaggggagcttcatctacttccgcctc gagtcgctctggttcctcgtcttcaaaggggcggcagcatga

DBGET integrated database retrieval system