Miscanthus floridulus: 136454464 Help Entry 136454464         CDS       T10264                                  Name (RefSeq) small COPII coat GTPase SAR1A   KO K07953   GTP-binding protein SAR1 [EC:3.6.5.-] Organism mflo  Miscanthus floridulus Pathway mflo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mflo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     136454464  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mflo04131]     136454464   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mflo04031]     136454464 Membrane trafficking [BR:mflo04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Coat protein complex II (COP-II)     136454464 GTP-binding proteins [BR:mflo04031]  Small (monomeric) G-proteins   Arf/Sar Family    Sar     136454464 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Aerolysin Motif Other DBs NCBI-GeneID:  136454464 NCBI-ProteinID:  XP_066310980 LinkDB All DBs Position 5:complement(29049041..29049358) Genome browser AA seq 105 aa AA seqDB search MLVVYLVDAVDKERFAESKKELDALLADDSLANVPFLILGNKIDIPYAASEEELRYYLGL SNFTTGKGNVNLADSNVRPLEIFMCSVVRKMGYGEGFKWMSQYIK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgctggttgtgtacttggtggacgctgttgacaaggaacggtttgccgagtcaaagaaa gaacttgatgcacttcttgcagatgactcccttgcaaacgttcctttcctcatactgggc aataagattgacatcccctacgcggcttcagaggaggagctgcggtactaccttggcctg agcaacttcacaaccgggaagggcaacgtgaacttggctgactccaacgttcggcccctg gagatcttcatgtgcagtgtggtgcgcaagatgggctatggtgaaggcttcaaatggatg tctcagtacatcaagtga

DBGET integrated database retrieval system