Miscanthus floridulus: 136459051 Help Entry 136459051         CDS       T10264                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism mflo  Miscanthus floridulus Pathway mflo04145   Phagocytosis mflo04517   IgSF CAM signaling mflo04814   Motor proteins Brite KEGG Orthology (KO) [BR:mflo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     136459051  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     136459051   09142 Cell motility    04814 Motor proteins     136459051  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mflo03037]     136459051    04812 Cytoskeleton proteins [BR:mflo04812]     136459051 Cilium and associated proteins [BR:mflo03037]  Motile cilia and associated proteins   Dynein arm    136459051 Cytoskeleton proteins [BR:mflo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      136459051 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  136459051 NCBI-ProteinID:  XP_066315051 LinkDB All DBs Position 6:111268456..111269264 Genome browser AA seq 93 aa AA seqDB search MLEGKAVVEDTDMPAKMQAQAMSAASRALDRFDVLDCRSIAAHIKKEFDAIHGPGWQCVV GSSFGCYFTHCKGSFIYFRLESLRFLVFKGAAA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggaaaggcggtggtggaggacaccgacatgccagcgaagatgcaggcgcag gcgatgtcggcggcgtccagggccctcgaccgcttcgacgtcctcgactgccggagcatc gcggctcacatcaagaaggagtttgacgcgatccatggccccggatggcaatgcgtggtt ggctccagcttcggctgctacttcacgcactgcaaggggagcttcatctacttccgcctc gagtcgctcaggttcctcgtcttcaaaggggcggcagcatga

DBGET integrated database retrieval system