Miscanthus floridulus: 136463228 Help Entry 136463228         CDS       T10264                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism mflo  Miscanthus floridulus Pathway mflo04517   IgSF CAM signaling mflo04814   Motor proteins Brite KEGG Orthology (KO) [BR:mflo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     136463228  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     136463228  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mflo03037]     136463228    04812 Cytoskeleton proteins [BR:mflo04812]     136463228 Cilium and associated proteins [BR:mflo03037]  Motile cilia and associated proteins   Dynein arm    136463228 Cytoskeleton proteins [BR:mflo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      136463228 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  136463228 NCBI-ProteinID:  XP_066318339 LinkDB All DBs Position 7:52349905..52350769 Genome browser AA seq 95 aa AA seqDB search MLEGKARVEDTDMPARMQAAATTAASRALDLFDVADCRGIAGHIKTEFDKRYGVGWQCVV GANFGCFFTHTSGTFIYFSLERLSFLLFKAAAAAS NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgttggaggggaaggcgcgggtggaggacacggacatgccggcgcggatgcaggcagcg gcgaccacggcggcctcccgcgcgctcgacctcttcgacgtcgccgactgccgcggcatc gccggccacatcaagacggagttcgacaagcggtacggcgtggggtggcagtgcgtggtg ggcgccaacttcgggtgcttcttcacccacaccagcggcaccttcatctacttctccctc gagcgcctctccttcctcctcttcaaggctgccgccgccgcctcctaa

DBGET integrated database retrieval system