Miscanthus floridulus: 136478187 Help Entry 136478187         CDS       T10264                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism mflo  Miscanthus floridulus Pathway mflo04136   Autophagy - other Brite KEGG Orthology (KO) [BR:mflo00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     136478187  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mflo04131]     136478187    04121 Ubiquitin system [BR:mflo04121]     136478187    03029 Mitochondrial biogenesis [BR:mflo03029]     136478187 Membrane trafficking [BR:mflo04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     136478187 Ubiquitin system [BR:mflo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    136478187 Mitochondrial biogenesis [BR:mflo03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     136478187 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  136478187 NCBI-ProteinID:  XP_066332631 LinkDB All DBs Position 8:218973584..218976163 Genome browser AA seq 91 aa AA seqDB search MAAEADQKVVVHVRSTGDAPILKQSKFKISGRDKFLKVIEFLRRQLHQDTLFVYINSVFS PNPDELVIDLYNNFGIDGKLVVNYALSAAWG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggccgcggaggcggatcagaaagtggtggtgcacgtgcggtcaacaggtgatgcgccg atcctgaagcaatccaaattcaagatttcaggacgagataagtttttgaaggtcatagag tttcttcgccgacaacttcatcaagatacactgtttgtctatatcaacagtgtgttttcg ccaaacccggatgaactggtaatcgacttgtataataactttggaattgatgggaaactg gtggtaaattatgctttatcagcagcatggggctaa

DBGET integrated database retrieval system