Miscanthus floridulus: 136484340 Help Entry 136484340         CDS       T10264                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism mflo  Miscanthus floridulus Pathway mflo03030   DNA replication mflo03410   Base excision repair mflo03420   Nucleotide excision repair mflo03430   Mismatch repair mflo03440   Homologous recombination Brite KEGG Orthology (KO) [BR:mflo00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     136484340    03410 Base excision repair     136484340    03420 Nucleotide excision repair     136484340    03430 Mismatch repair     136484340    03440 Homologous recombination     136484340  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mflo03032]     136484340    03400 DNA repair and recombination proteins [BR:mflo03400]     136484340 DNA replication proteins [BR:mflo03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     136484340 DNA repair and recombination proteins [BR:mflo03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       136484340    MMR (mismatch excision repair)     DNA polymerase delta complex      136484340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  136484340 NCBI-ProteinID:  XP_066337691 LinkDB All DBs Position 1:complement(55520199..55521580) Genome browser AA seq 130 aa AA seqDB search MTRGGGGDMKSFFRQQKAHAGAGAATKPTGGVSMKAAAAAAQHHQKAAPAVHVHPAPDHG AGAGADSTRLQQEERERAAREFDMDMRYGPCLGVTRAQRWRRASSLGLAPPPALLALCTD DQPCLWEGRV NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgacgaggggcggcggaggcgacatgaagtctttcttccgtcagcagaaggcgcacgcc ggcgccggggccgcaaccaagcccaccggcggcgtctccatgaaggcggcggcggcggcg gcgcaacaccaccagaaggccgctcccgccgttcacgtccacccggcaccagatcacggc gccggcgccggcgccgactcgacgaggctccagcaggaggagcgggagcgggcggcccgc gagttcgacatggacatgcgctacgggccgtgcctcggcgtcacccgcgcccagcgctgg cgccgcgcctcctcgctcggcctcgcgccgccgccggcgctcctcgccctctgcaccgat gaccagccctgcctctgggagggccgcgtctag

DBGET integrated database retrieval system