Miscanthus floridulus: 136512793 Help Entry 136512793         CDS       T10264                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mflo  Miscanthus floridulus Pathway mflo04145   Phagosome mflo04148   Efferocytosis mflo04517   IgSF CAM signaling mflo04518   Integrin signaling mflo04519   Cadherin signaling mflo04620   Toll-like receptor signaling pathway mflo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mflo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     136512793    04518 Integrin signaling     136512793    04519 Cadherin signaling     136512793  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     136512793    04148 Efferocytosis     136512793  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136512793  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     136512793  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mflo04131]     136512793   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mflo04147]     136512793    04031 GTP-binding proteins [BR:mflo04031]     136512793 Membrane trafficking [BR:mflo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     136512793  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     136512793   Macropinocytosis    Ras GTPases     136512793  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     136512793 Exosome [BR:mflo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136512793   Exosomal proteins of other body fluids (saliva and urine)    136512793   Exosomal proteins of colorectal cancer cells    136512793   Exosomal proteins of bladder cancer cells    136512793 GTP-binding proteins [BR:mflo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     136512793 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  136512793 NCBI-ProteinID:  XP_066362885 LinkDB All DBs Position 16:103751711..103754517 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISRASYENVLKKWMPELRRFAPNVPVVLVGTKL DLRDHRAYLADHPGASTITTAQGEELRKQIGAAAYIECSSKTQQNVKSVFDTAIKVVLQP PRRWEAMPARKKNRRGSGCSIMNLMCGSTCAA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcatcaagtgcgtcacggtcggggacggcgccgtgggcaagacc tgcatgctcatctgctataccagcaacaagttccccacggattacatccccacggtgttc gacaacttcagcgccaacgtctccgtggatggcaacatcgtcaacctgggcctctgggac actgcagggcaagaggactacagcaggctgcggccactgagctacaggggcgcagatgtg ttcgtgctggctttctccctgatcagcagggcgagctatgagaatgttcttaagaagtgg atgccagagcttcgccgatttgcgcccaacgttccggttgttcttgttgggaccaagtta gatctccgtgaccacagagcctaccttgctgaccatcctggagcatcgacaatcacgacg gcacagggtgaagaactgaggaagcagattggtgctgcagcttacatcgagtgcagttcc aaaacccagcagaatgtcaagtctgtcttcgatacagccattaaagtggtccttcaaccc ccacggagatgggaggcaatgcctgccaggaagaaaaacaggcgtggctccggatgctct ataatgaaccttatgtgtggcagcacgtgtgctgcttag

DBGET integrated database retrieval system