Miscanthus floridulus: 136515039 Help Entry 136515039         CDS       T10264                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mflo  Miscanthus floridulus Pathway mflo04145   Phagosome mflo04148   Efferocytosis mflo04517   IgSF CAM signaling mflo04518   Integrin signaling mflo04620   Toll-like receptor signaling pathway mflo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mflo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     136515039    04518 Integrin signaling     136515039  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     136515039    04148 Efferocytosis     136515039  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136515039  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     136515039  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mflo04131]     136515039   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mflo04147]     136515039    04031 GTP-binding proteins [BR:mflo04031]     136515039 Membrane trafficking [BR:mflo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     136515039  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     136515039   Macropinocytosis    Ras GTPases     136515039  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     136515039 Exosome [BR:mflo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136515039   Exosomal proteins of other body fluids (saliva and urine)    136515039   Exosomal proteins of colorectal cancer cells    136515039   Exosomal proteins of bladder cancer cells    136515039 GTP-binding proteins [BR:mflo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     136515039 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  136515039 NCBI-ProteinID:  XP_066364828 LinkDB All DBs Position 17:91558329..91564241 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISRASYENVLKKWMPELRRFAPNVPVVLVGTKL DLRDHRAYLADHPGASTITTAQGEELRKQIGAAAYIECSSKTQQNVKSVFDTAIKVVLQP PRRREAMPARKKNRRGSGCSIMNLMCGSTCAA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcatcaagtgcgtcacggtcggggacggcgccgtgggcaagacc tgcatgctcatctgctacaccagcaacaagttccccacggattacatccccacggtgttc gacaacttcagcgccaacgtctccgtggatggcaacatcgtcaacctgggcctctgggac actgcggggcaagaggactacagcaggctgcggccgctgagctacaggggcgcagatgtg ttcgtgctggctttctccctgatcagcagggccagctatgagaatgttcttaagaagtgg atgccagagcttcgccgatttgcgcccaacgttccggttgttcttgttgggaccaagtta gatctccgtgaccacagagcctaccttgctgaccatcctggagcttcgacaatcacgacg gcacagggtgaagaactgaggaagcagattggtgctgcagcttacatcgagtgcagttcc aaaacccagcagaatgtcaagtctgtcttcgatacagccattaaagtggtccttcaaccc ccacggagaagggaggcaatgcctgccaggaagaaaaacaggcgtggctccggatgctcc ataatgaaccttatgtgtggcagcacgtgtgctgcttag

DBGET integrated database retrieval system