Mycolicibacterium fluoranthenivorans: HZU40_27500
Help
Entry
HZU40_27500 CDS
T11067
Name
(GenBank) PE family protein
Organism
mflu Mycolicibacterium fluoranthenivorans
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PGRS
Motif
Other DBs
NCBI-ProteinID:
QNJ91885
UniProt:
A0A7G8PC19
LinkDB
All DBs
Position
complement(5565311..5567086)
Genome browser
AA seq
591 aa
AA seq
DB search
MRNYIYPCATGIAMVGAGAALALGAGAAQASPLLAPAPAPLTSLQSPSAGVQCLMVATGC
PSGVVTTTSGAVSYLALTPTPNALAAAFVGPTMHSPLYNLIGIGNFIPIVNIFVSNGTNG
AAGTGANGGNGGLLMGFGGAGGSGAVGQAGGSGGKGGFFVGNGGGGGAGGIGASGGNGGN
AGTLALLGHGGNGGVGGSGSAGTVGATGAGTAASGTTGTTGAAGGTGADGVNPAAGGPAG
VAGAEGAAGTVTGGDGLPGSSGNPGGAGGAGGAVAGTALVATGGTGAAGASGTDGGNGGA
GGAGGASSTTGAGGTAIGGDGANGGNGGTGATDGGAGGAGGAGVSVSGVGVGGDGGIGGD
GGIGAAGQSGGAGGTGGTGTTGANGTNVGGTGTAGGPAGTGGNGGSGGLFGSGGAAGNGG
TGGTGGAGGTGQAGGSGGTGGTGGAGGTGGNGDAGGNGGSGGAGGAGTGAGGTGVGGTGG
AGGTGATGGPGGSGGTSGTGGAGGTGGTGAAGGSGGTGGNGAAAGTAGHSGVFGSNGHTG
TTGANGATGNTGATGSTGATGSTGASGATGNAGSSGAGGNAGSPGANGASS
NT seq
1776 nt
NT seq
+upstream
nt +downstream
nt
atgagaaactacatctatccgtgcgcgaccggtattgccatggtcggagcgggcgccgca
ttggctctcggagcgggcgccgcacaagcgtcaccgctgctcgctcccgcacctgcccct
ctgacgtcccttcaatcaccgtcggcgggcgtgcagtgcctcatggtggccaccggatgc
ccgtcaggtgtggtgacgacgacgagtggcgcggtcagctacttggcactcacgcccact
ccgaacgctctggccgctgccttcgtcggtcccacgatgcattcgccgctctacaacctc
atcggtatcggcaacttcatcccgattgtgaacatcttcgtcagcaatgggaccaacggt
gcggcaggcacgggcgccaacggcggtaacggcggcctgttgatgggcttcggtggtgcc
ggtggatccggtgccgtggggcaagccggcggcagcggcggcaagggcgggttcttcgtg
ggcaacggcggtggcggcggagccggcgggatcggcgcgtcgggcggcaacggcggtaac
gccggcaccttggcgctgctcggtcacggcggtaacggcggcgtcgggggtagcggttcg
gcaggcacagttggtgcgacgggcgcgggcaccgctgccagcggtacgaccggtacaact
ggcgcggcgggcgggaccggagccgacggcgtcaatcccgccgcgggcggtccggcggga
gttgcaggtgctgagggcgccgccggcacggtgaccggtggcgacggcctccccggtagt
tcgggcaaccccggtggagccggtggcgcgggtggcgcggtggcaggcacggcactggtg
gcaacgggcggtaccggcgccgccggtgccagcggtaccgatggtggcaacggtggagcc
ggaggcgcgggcggcgcctcctcgacaacgggtgccggtggcacggctatcggtggtgat
ggcgccaacggtggcaacggcggaaccggggccaccgacggcggcgccggaggtgccggt
ggcgcgggagtcagcgtcagcggagtgggagtgggcggtgacggtggcatcggcggtgac
ggtggcatcggcgctgccggacagtccggtggagcaggcggcaccggcggtaccggcacc
acgggtgccaatggcaccaacgtcggaggcaccggcaccgccggcggcccggcgggcacc
ggcggcaacggcggcagtggcggcctcttcggcagcggcggcgcggcgggtaacggcggc
accggtggcaccggcggcgcgggtggcaccggccaagccggtggtagcggcggcacgggt
ggtaccggcggcgcgggtggcaccggtggcaatggcgatgccggcggcaacggtggctca
ggtggcgcgggtggcgcaggcaccggcgccggcgggaccggggtcggtggaaccggtgga
gccggtggtaccggcgccacaggtggtccgggcgggtccggagggaccagcggaaccggc
ggcgccggcggcacgggtggtaccggtgcggcaggcggcagcggtggcaccggtggtaac
ggtgcggcagccggtactgccggtcacagtggtgttttcggcagcaacggccataccggc
accacgggtgccaacggcgcgacgggtaacaccggggcgaccggctccaccggggcgacg
ggtagcaccggggcatccggtgcgaccggcaacgccggcagcagcggcgccggtggcaat
gccggctctcccggagcgaatggcgcgtcgtcgtag
DBGET
integrated database retrieval system