Mariprofundus ferrinatatus: Ga0123462_0530 Help Entry Ga0123462_0530    CDS       T05213                                  Name (GenBank) bacterial nucleoid protein Hbs   KO K03530   DNA-binding protein HU-beta Organism mfn  Mariprofundus ferrinatatus Brite KEGG Orthology (KO) [BR:mfn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mfn03032]     Ga0123462_0530    03036 Chromosome and associated proteins [BR:mfn03036]     Ga0123462_0530    03400 DNA repair and recombination proteins [BR:mfn03400]     Ga0123462_0530 DNA replication proteins [BR:mfn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Ga0123462_0530 Chromosome and associated proteins [BR:mfn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     Ga0123462_0530 DNA repair and recombination proteins [BR:mfn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       Ga0123462_0530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  ATX81403 UniProt:  A0A2K8L2C2 LinkDB All DBs Position 543106..543378 Genome browser AA seq 90 aa AA seqDB search MNKADLVNHVAASADLSKAAAGAAVEAVLGGISGALAGGNSVSLVGFGTFSVAERAARTA RNPRTGDTIQVAASKAPKFKAGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaagcagatttggtaaaccacgtggccgcatcggcggacctcagcaaggcagca gcaggcgcagcagttgaagctgtgctgggcggtatcagcggcgctcttgctggcggtaac tccgtaagcctcgtaggttttggaacattctcagtggcagaacgtgcagcacgtaccgca cgcaatccacgtactggcgacaccattcaggtggccgcatctaaggcgcctaaattcaaa gctggtaaggctcttaaagacgcagtaaaataa

DBGET integrated database retrieval system