Mariprofundus ferrinatatus: Ga0123462_1460 Help Entry Ga0123462_1460    CDS       T05213                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mfn  Mariprofundus ferrinatatus Pathway mfn01100   Metabolic pathways mfn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mfn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ga0123462_1460    00074 Mycolic acid biosynthesis     Ga0123462_1460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ga0123462_1460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ATX82323 UniProt:  A0A2K8L512 LinkDB All DBs Position complement(1499848..1500087) Genome browser AA seq 79 aa AA seqDB search MSAEIEAKIIKIVSDQLNVDEEEINPDSSFVDDLGADSLDTVELVMAFEEEFGVEIPDED AEGIQSVQNAIDYIAAKAE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtctgcagaaatcgaagctaaaatcattaaaattgtttccgatcagctgaatgttgat gaggaagagatcaatcctgattcatcattcgtagatgacctgggcgctgattcactggac accgtagagctggtgatggctttcgaagaggagttcggtgttgaaattccggacgaagat gcagaaggcatccagagcgtacagaacgcaatcgactatatcgctgccaaagctgaataa

DBGET integrated database retrieval system