Methanoregula formicica: Metfor_0075 Help Entry Metfor_0075       CDS       T02392                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism mfo  Methanoregula formicica Pathway mfo00400   Phenylalanine, tyrosine and tryptophan biosynthesis mfo01100   Metabolic pathways mfo01110   Biosynthesis of secondary metabolites mfo01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:mfo00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     Metfor_0075 Enzymes [BR:mfo01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      Metfor_0075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Osmo_CC Motif Other DBs NCBI-ProteinID:  AGB01161 UniProt:  L0HBJ8 LinkDB All DBs Position 65595..65879 Genome browser AA seq 94 aa AA seqDB search MSLDHVRNEIAKVDRDIIALIAKRQELAKRVAAIKIREGIAIHDGRQSQKVLVSVFDRAV ESKIDPVAVQKIFEILITMSEERQRECSGDGNLP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtccctcgatcatgtccgtaacgagatcgcgaaggtggaccgggatatcatcgcactc atcgcgaaacggcaggagctggcgaaacgcgttgcggccatcaagatacgcgaagggatc gccatccatgatggaagacagtcacaaaaggtcctcgtatcagtctttgacagggcggtc gagagcaagatcgacccggtcgctgtccagaagatcttcgagatcctcattaccatgagc gaggagcgccagagggagtgctccggggacggcaacctgccgtga

DBGET integrated database retrieval system