Methanoregula formicica: Metfor_2872 Help Entry Metfor_2872       CDS       T02392                                  Name (GenBank) ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mfo  Methanoregula formicica Pathway mfo03010   Ribosome Brite KEGG Orthology (KO) [BR:mfo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Metfor_2872   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Metfor_2872  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mfo03011]     Metfor_2872    04121 Ubiquitin system [BR:mfo04121]     Metfor_2872   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfo04147]     Metfor_2872 Ribosome [BR:mfo03011]  Ribosomal proteins   Eukaryotes    Small subunit     Metfor_2872   Archaea     Metfor_2872 Ubiquitin system [BR:mfo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Metfor_2872 Exosome [BR:mfo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Metfor_2872   Exosomal proteins of colorectal cancer cells    Metfor_2872 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_Ribbon_1 Zn_ribbon_Nudix Cas12f1-like_TNB IBR Rcat_RNF216 Ribosomal_L37e Auto_anti-p27 MqsA_antitoxin HVO_0416 Zn_ribbon_RPB9 DUF1451 Lar_restr_allev HypA PknG_rubred Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AGB03854 UniProt:  L0HLC0 LinkDB All DBs Position 2769979..2770161 Genome browser AA seq 60 aa AA seqDB search MAAKKAAASKAPKRGAYFKVEGAKVTTEKKYCPRCGPGVMMADHKDRTTCGKCGYTEFRK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggcagcaaagaaggcggcagcctcaaaagcccccaagagaggcgcatacttcaaggtc gagggtgcgaaggtcaccaccgaaaagaaatactgcccgcgctgcggacccggtgtcatg atggcggaccacaaggaccggaccacctgcggaaagtgcggatataccgaattcagaaag taa

DBGET integrated database retrieval system