Montipora foliosa: 137974811 Help Entry 137974811         CDS       T10576                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism mfoo  Montipora foliosa Pathway mfoo04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mfoo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     137974811  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mfoo04121]     137974811    03400 DNA repair and recombination proteins [BR:mfoo03400]     137974811 Ubiquitin system [BR:mfoo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      137974811    Cul5 complex      137974811 DNA repair and recombination proteins [BR:mfoo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      137974811 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  137974811 NCBI-ProteinID:  XP_068677904 LinkDB All DBs Position 11:complement(16963122..16969747) Genome browser AA seq 116 aa AA seqDB search MEIFVMVRREKTTIFLDCKEATTVYELKKMVEGITKKGPDDQRLYKDDQILDDAKTLEDC GFTTQTAKAQSPALISLSFRGEDGEFEPVVIAPLSTPPELPDVMKPQESIPSSDGS NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggagatttttgtgatggtgcgtcgtgaaaagacaaccattttccttgattgcaaggaa gccaccactgtctacgaattaaagaaaatggttgaagggattacaaagaagggtcctgat gatcagaggttgtacaaggatgatcagatactcgatgatgctaaaactttggaggattgc ggctttacaacgcaaactgccaaggcacaatccccggcattgattagcttgtcattcaga ggagaagacggagagtttgagccagtggtgattgcacccttgtccacccctccagaatta cctgatgtgatgaaaccacaggaaagcattcccagcagtgatgggtcttga

DBGET integrated database retrieval system