Montipora foliosa: 137994555 Help Entry 137994555         CDS       T10576                                  Name (RefSeq) ras-like GTP-binding protein RHO   KO K04513   Ras homolog gene family, member A Organism mfoo  Montipora foliosa Pathway mfoo04081   Hormone signaling mfoo04144   Endocytosis mfoo04150   mTOR signaling pathway mfoo04310   Wnt signaling pathway mfoo04350   TGF-beta signaling pathway mfoo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mfoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     137994555    04350 TGF-beta signaling pathway     137994555    04150 mTOR signaling pathway     137994555   09133 Signaling molecules and interaction    04081 Hormone signaling     137994555  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     137994555  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     137994555  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfoo04131]     137994555   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfoo04147]     137994555    04031 GTP-binding proteins [BR:mfoo04031]     137994555 Membrane trafficking [BR:mfoo04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     137994555 Exosome [BR:mfoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137994555   Exosomal proteins of other body fluids (saliva and urine)    137994555   Exosomal proteins of colorectal cancer cells    137994555   Exosomal proteins of bladder cancer cells    137994555 GTP-binding proteins [BR:mfoo04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     137994555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 LAG1-DNAbind Motif Other DBs NCBI-GeneID:  137994555 NCBI-ProteinID:  XP_068696240 LinkDB All DBs Position 3:17645470..17647101 Genome browser AA seq 196 aa AA seqDB search MAANRPISKKMVTVGDSSCGKTCLYTTFARDRFPVEYVPRVFESYLVGIRVDDKTVELGF WDTVGDAEYDRVRPLSYLYTDVILMCFSFDSPESLAKVLEKWTPEVRHFCPDVPIILVGN KKDLKNDESTKRELSKMKQEPVKSEEGSLMCERIKAYAYLECSAKTKEGVRDVFTTAARA ALMTKGRRNKRKCCLV NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atggcagccaacagacccattagcaaaaagatggtcaccgtaggtgacagttcctgtgga aaaacctgcctttacactacgttcgccagagatcgattccctgtagagtacgtaccaaga gtttttgagagttatcttgttggtatcagagttgatgacaagacagtagagctaggattc tgggatacggtgggagacgcagaatatgacagggtacgacctctttcctatctttacact gatgttattctgatgtgcttctcctttgatagtcctgagagtttagctaaagttcttgaa aaatggactcctgaagttaggcatttctgcccagatgtaccaattatattggtcggtaac aagaaagatctgaaaaatgacgaaagcacaaagagagagttatccaagatgaaacaagag cccgttaaaagtgaagaaggatctttaatgtgtgaaagaatcaaggcctatgcttacctg gaatgttctgctaaaacaaaagagggagttagagatgtatttacaacagctgcgagagct gcactgatgacgaaaggaaggcgaaataaacgaaaatgttgcttagtgtaa

DBGET integrated database retrieval system