Marvinbryantia formatexigens: NQ534_18995 Help Entry NQ534_18995       CDS       T08439                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mfor  Marvinbryantia formatexigens Pathway mfor01100   Metabolic pathways mfor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mfor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NQ534_18995 (acpP)    00074 Mycolic acid biosynthesis     NQ534_18995 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NQ534_18995 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 TerB PP-binding_2 Motif Other DBs NCBI-ProteinID:  UWO24478 LinkDB All DBs Position 4068002..4068232 Genome browser AA seq 76 aa AA seqDB search MELEKLQKIIAEVMNVDADEITTDMTFVDDIGADSLDVYQIIMGIEEEFDIEIPTEEAEK IVSVGDAVEAIRNAVN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaattagagaaattgcagaaaattattgcggaagttatgaatgtggatgcggatgag attaccacggatatgacctttgtggatgacatcggtgcggattcgctggatgtttatcag attattatgggcatcgaagaggaatttgatattgagattccgacagaagaagcggaaaaa atcgtttcggtaggcgatgcggtagaagcaatcagaaatgcagtgaattaa

DBGET integrated database retrieval system