Alexandromys fortis (reed vole): 126487150 Help Entry 126487150         CDS       T08493                                  Name (RefSeq) cytochrome c, testis-specific   KO K08738   cytochrome c Organism mfot  Alexandromys fortis (reed vole) Pathway mfot00190   Oxidative phosphorylation mfot01100   Metabolic pathways mfot01524   Platinum drug resistance mfot04115   p53 signaling pathway mfot04210   Apoptosis mfot04215   Apoptosis - multiple species mfot04932   Non-alcoholic fatty liver disease mfot05010   Alzheimer disease mfot05012   Parkinson disease mfot05014   Amyotrophic lateral sclerosis mfot05016   Huntington disease mfot05017   Spinocerebellar ataxia mfot05020   Prion disease mfot05022   Pathways of neurodegeneration - multiple diseases mfot05132   Salmonella infection mfot05134   Legionellosis mfot05145   Toxoplasmosis mfot05152   Tuberculosis mfot05160   Hepatitis C mfot05161   Hepatitis B mfot05162   Measles mfot05163   Human cytomegalovirus infection mfot05164   Influenza A mfot05167   Kaposi sarcoma-associated herpesvirus infection mfot05168   Herpes simplex virus 1 infection mfot05169   Epstein-Barr virus infection mfot05170   Human immunodeficiency virus 1 infection mfot05200   Pathways in cancer mfot05210   Colorectal cancer mfot05222   Small cell lung cancer mfot05416   Viral myocarditis mfot05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     126487150  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     126487150    04215 Apoptosis - multiple species     126487150    04115 p53 signaling pathway     126487150  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126487150   09162 Cancer: specific types    05210 Colorectal cancer     126487150    05222 Small cell lung cancer     126487150   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     126487150    05161 Hepatitis B     126487150    05160 Hepatitis C     126487150    05164 Influenza A     126487150    05162 Measles     126487150    05168 Herpes simplex virus 1 infection     126487150    05163 Human cytomegalovirus infection     126487150    05167 Kaposi sarcoma-associated herpesvirus infection     126487150    05169 Epstein-Barr virus infection     126487150   09171 Infectious disease: bacterial    05132 Salmonella infection     126487150    05134 Legionellosis     126487150    05152 Tuberculosis     126487150   09174 Infectious disease: parasitic    05145 Toxoplasmosis     126487150   09164 Neurodegenerative disease    05010 Alzheimer disease     126487150    05012 Parkinson disease     126487150    05014 Amyotrophic lateral sclerosis     126487150    05016 Huntington disease     126487150    05017 Spinocerebellar ataxia     126487150    05020 Prion disease     126487150    05022 Pathways of neurodegeneration - multiple diseases     126487150   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     126487150    05416 Viral myocarditis     126487150   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     126487150   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     126487150 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  126487150 NCBI-ProteinID:  XP_049975784 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGIVW TEATLMEYLENPKKFIPGTKMIFAGIKKKSEREDLIQYLKRATSS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggagatgctgaagcaggcaagaagatctttgttcagaaatgcgctcagtgccacacg gtggagaaaggtgggaagcacaagactggtccaaacctctggggccttttcggccggaag acaggacaagcaccaggattttcttacaccgatgcgaacaagaataaaggtattgtctgg acagaagcaactttgatggaatatttggagaacccaaagaaattcatccctggcactaaa atgatctttgctggtatcaaaaagaagagtgagagagaagatcttattcagtatttgaaa cgggcaacatcctcatga

DBGET integrated database retrieval system