Alexandromys fortis (reed vole): 126487474 Help Entry 126487474         CDS       T08493                                  Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04015   Rap1 signaling pathway mfot04810   Regulation of actin cytoskeleton mfot05014   Amyotrophic lateral sclerosis mfot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     126487474  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     126487474  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126487474   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     126487474  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfot04131]     126487474   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mfot04812]     126487474    04147 Exosome [BR:mfot04147]     126487474 Membrane trafficking [BR:mfot04131]  Others   Actin-binding proteins    Others     126487474 Cytoskeleton proteins [BR:mfot04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      126487474 Exosome [BR:mfot04147]  Exosomal proteins   Proteins found in most exosomes    126487474 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  126487474 NCBI-ProteinID:  XP_049976211 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggttgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggtgcaaagaagtgttcagtgatcagagatagcctatacgtt gatggtgactgcacaatggatatccggacaaagagtcaaggtggggagccaacatacaat gttgctgttggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system