Alexandromys fortis (reed vole): 126488776 Help Entry 126488776         CDS       T08493                                  Name (RefSeq) glutathione S-transferase P-like   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism mfot  Alexandromys fortis (reed vole) Pathway mfot00480   Glutathione metabolism mfot00980   Metabolism of xenobiotics by cytochrome P450 mfot00982   Drug metabolism - cytochrome P450 mfot00983   Drug metabolism - other enzymes mfot01100   Metabolic pathways mfot01524   Platinum drug resistance mfot05200   Pathways in cancer mfot05204   Chemical carcinogenesis - DNA adducts mfot05215   Prostate cancer mfot05225   Hepatocellular carcinoma mfot05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     126488776   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     126488776    00982 Drug metabolism - cytochrome P450     126488776    00983 Drug metabolism - other enzymes     126488776  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126488776    05204 Chemical carcinogenesis - DNA adducts     126488776   09162 Cancer: specific types    05225 Hepatocellular carcinoma     126488776    05215 Prostate cancer     126488776   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     126488776   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     126488776  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mfot02000]     126488776 Enzymes [BR:mfot01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      126488776 Transporters [BR:mfot02000]  Other transporters   Pores ion channels [TC:1]    126488776 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_2 AHC1_C GST_N_3 Motif Other DBs NCBI-GeneID:  126488776 NCBI-ProteinID:  XP_049978414 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MPPYTIVYFPVRGRCEAMRILLADQDQSWKEEVVSIDTWMKGVLKSTCLYGQLPKFQDGD LTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRLKYITLIYTKYEEGKDDYV KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDDFPLLSAY VARLSARPKIKAFLSSPDHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccgtacaccattgtctacttcccagttcgagggcgctgtgaggccatgcgcata ctcctggctgaccaggaccagagctggaaggaggaggtggtgtccatagatacttggatg aaaggcgtgctcaagtccacctgtctgtatgggcagctccccaagtttcaggatggagac cttaccctgtaccaatctaatgccatcttgaggcacctgggccgatcccttgggctttat ggaaaagatcagaaggaggctgccctggtggatatggtgaatgacggggtggaagacctt cgcctgaaatacatcaccctcatctacaccaaatatgaggaagggaaggatgactatgtg aaggccctgcctggacacctgaaacctttcgagaccctgctgtcccagaaccaaggaggc aaagccttcatcgtgggtgaccagatctccttcgccgattacaacttgctagatctgctg ctgatccaccaggtcctggcccctggctgcctggacgacttccccctgctcagtgcctat gtggcgcgcctcagtgcccggcccaagatcaaggccttcctgtcctcccctgaccatgtg aaccgtcccatcaatggcaacggcaagcagtaa

DBGET integrated database retrieval system