Alexandromys fortis (reed vole): 126489678
Help
Entry
126489678 CDS
T08493
Name
(RefSeq) interleukin-17A
KO
K05489
interleukin 17A
Organism
mfot
Alexandromys fortis (reed vole)
Pathway
mfot04060
Cytokine-cytokine receptor interaction
mfot04657
IL-17 signaling pathway
mfot04659
Th17 cell differentiation
mfot04936
Alcoholic liver disease
mfot05321
Inflammatory bowel disease
mfot05323
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:
mfot00001
]
09130 Environmental Information Processing
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
126489678
09150 Organismal Systems
09151 Immune system
04659 Th17 cell differentiation
126489678
04657 IL-17 signaling pathway
126489678
09160 Human Diseases
09163 Immune disease
05323 Rheumatoid arthritis
126489678
05321 Inflammatory bowel disease
126489678
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
126489678
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
mfot04052
]
126489678
Cytokines and neuropeptides [BR:
mfot04052
]
Cytokines
Interleukins
126489678
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
IL17
Motif
Other DBs
NCBI-GeneID:
126489678
NCBI-ProteinID:
XP_049980022
LinkDB
All DBs
Position
Unknown
AA seq
158 aa
AA seq
DB search
MSPGRSSSLSLLLLLLLSLKAVVKAGLPIPQSSGCPNTEGKNFLQNVKVNLTVLNSLSPK
LSSRRPSDYLNRSTSPWTLHRNEDPNRYPSVIWEAQCRHQRCVNAQGKLEHHMNSVLLQQ
EILVLKREPENCPFSFRVEKMLVGVGCTCVSSIVRHVA
NT seq
477 nt
NT seq
+upstream
nt +downstream
nt
atgagtcccgggagatcttcgtctctgtctctgctgctgttgctgctgctgagcctaaag
gctgtggtgaaggcagggttacctatcccacaaagttcgggatgtccaaacacagagggc
aagaactttctccagaatgtgaaggtcaacctgacagtcctgaactcccttagtccgaaa
ctgagttcccgaaggccctcagactacctcaaccgatccacctcgccctggactctccac
cgcaacgaggaccctaacagatatccttctgtgatctgggaggcacagtgccgccaccag
cgctgtgtcaatgctcaggggaagttggagcaccacatgaactctgttctcctccagcaa
gagatcctggttctgaagagggagcctgagaactgtcccttctccttccgggtggagaag
atgctggtgggtgtgggctgcacctgcgtgtcctccatcgtccgccacgtggcctaa
DBGET
integrated database retrieval system