Alexandromys fortis (reed vole): 126489760 Help Entry 126489760         CDS       T08493                                  Name (RefSeq) myosin light polypeptide 6-like   KO K12751   myosin light chain 6 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04270   Vascular smooth muscle contraction mfot04530   Tight junction mfot04814   Motor proteins mfot04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:mfot00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     126489760   09142 Cell motility    04814 Motor proteins     126489760  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     126489760   09153 Circulatory system    04270 Vascular smooth muscle contraction     126489760  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mfot04812]     126489760    04147 Exosome [BR:mfot04147]     126489760 Cytoskeleton proteins [BR:mfot04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      126489760 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    126489760   Exosomal proteins of bladder cancer cells    126489760 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_7 AIF-1 EF_EFCAB10_C EF-hand_5 EF-hand_9 Motif Other DBs NCBI-GeneID:  126489760 NCBI-ProteinID:  XP_049980197 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM TEEEVEMLVAGHEDSNGCINYEELVRMVLNS NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtgtgacttcaccgaggaccagaccgcagagttcaaggaggctttccagctgtttgac cgaacaggtgatggcaagatcctgtacagccaatgtggggacgtgatgagggccctgggc cagaaccctaccaacgccgaggtgctcaaggtcctggggaaccctaagagcgatgagatg aatgtgaaggtgctggacttcgagcacttcctgcccatgttgcagactgtggccaagaac aaggaccagggaacttatgaggactatgtcgaaggccttcgtgtgttcgacaaggaaggg aatggtaccgtcatgggtgctgaaatccggcatgtcctcgtcacactgggagagaagatg acagaggaggaagtggagatgctggtggcgggtcatgaggacagcaacggttgtatcaac tatgaagagcttgtccggatggtgctgaacagctga

DBGET integrated database retrieval system