KEGG   Alexandromys fortis (reed vole): 126489822
Entry
126489822         CDS       T08493                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
mfot  Alexandromys fortis (reed vole)
Pathway
mfot04010  MAPK signaling pathway
mfot04014  Ras signaling pathway
mfot04015  Rap1 signaling pathway
mfot04024  cAMP signaling pathway
mfot04062  Chemokine signaling pathway
mfot04071  Sphingolipid signaling pathway
mfot04145  Phagosome
mfot04148  Efferocytosis
mfot04151  PI3K-Akt signaling pathway
mfot04310  Wnt signaling pathway
mfot04360  Axon guidance
mfot04370  VEGF signaling pathway
mfot04380  Osteoclast differentiation
mfot04510  Focal adhesion
mfot04520  Adherens junction
mfot04530  Tight junction
mfot04613  Neutrophil extracellular trap formation
mfot04620  Toll-like receptor signaling pathway
mfot04650  Natural killer cell mediated cytotoxicity
mfot04662  B cell receptor signaling pathway
mfot04664  Fc epsilon RI signaling pathway
mfot04666  Fc gamma R-mediated phagocytosis
mfot04670  Leukocyte transendothelial migration
mfot04722  Neurotrophin signaling pathway
mfot04810  Regulation of actin cytoskeleton
mfot04932  Non-alcoholic fatty liver disease
mfot04933  AGE-RAGE signaling pathway in diabetic complications
mfot04972  Pancreatic secretion
mfot05014  Amyotrophic lateral sclerosis
mfot05020  Prion disease
mfot05022  Pathways of neurodegeneration - multiple diseases
mfot05100  Bacterial invasion of epithelial cells
mfot05132  Salmonella infection
mfot05135  Yersinia infection
mfot05163  Human cytomegalovirus infection
mfot05167  Kaposi sarcoma-associated herpesvirus infection
mfot05169  Epstein-Barr virus infection
mfot05170  Human immunodeficiency virus 1 infection
mfot05200  Pathways in cancer
mfot05203  Viral carcinogenesis
mfot05205  Proteoglycans in cancer
mfot05208  Chemical carcinogenesis - reactive oxygen species
mfot05210  Colorectal cancer
mfot05211  Renal cell carcinoma
mfot05212  Pancreatic cancer
mfot05231  Choline metabolism in cancer
mfot05415  Diabetic cardiomyopathy
mfot05416  Viral myocarditis
mfot05417  Lipid and atherosclerosis
mfot05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mfot00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    126489822
   04014 Ras signaling pathway
    126489822
   04015 Rap1 signaling pathway
    126489822
   04310 Wnt signaling pathway
    126489822
   04370 VEGF signaling pathway
    126489822
   04071 Sphingolipid signaling pathway
    126489822
   04024 cAMP signaling pathway
    126489822
   04151 PI3K-Akt signaling pathway
    126489822
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    126489822
   04148 Efferocytosis
    126489822
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    126489822
   04520 Adherens junction
    126489822
   04530 Tight junction
    126489822
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    126489822
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    126489822
   04620 Toll-like receptor signaling pathway
    126489822
   04650 Natural killer cell mediated cytotoxicity
    126489822
   04662 B cell receptor signaling pathway
    126489822
   04664 Fc epsilon RI signaling pathway
    126489822
   04666 Fc gamma R-mediated phagocytosis
    126489822
   04670 Leukocyte transendothelial migration
    126489822
   04062 Chemokine signaling pathway
    126489822
  09154 Digestive system
   04972 Pancreatic secretion
    126489822
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    126489822
  09158 Development and regeneration
   04360 Axon guidance
    126489822
   04380 Osteoclast differentiation
    126489822
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126489822
   05205 Proteoglycans in cancer
    126489822
   05208 Chemical carcinogenesis - reactive oxygen species
    126489822
   05203 Viral carcinogenesis
    126489822
   05231 Choline metabolism in cancer
    126489822
  09162 Cancer: specific types
   05210 Colorectal cancer
    126489822
   05212 Pancreatic cancer
    126489822
   05211 Renal cell carcinoma
    126489822
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    126489822
   05163 Human cytomegalovirus infection
    126489822
   05167 Kaposi sarcoma-associated herpesvirus infection
    126489822
   05169 Epstein-Barr virus infection
    126489822
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    126489822
   05135 Yersinia infection
    126489822
   05100 Bacterial invasion of epithelial cells
    126489822
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    126489822
   05020 Prion disease
    126489822
   05022 Pathways of neurodegeneration - multiple diseases
    126489822
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126489822
   05418 Fluid shear stress and atherosclerosis
    126489822
   05415 Diabetic cardiomyopathy
    126489822
   05416 Viral myocarditis
    126489822
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    126489822
   04933 AGE-RAGE signaling pathway in diabetic complications
    126489822
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mfot04131]
    126489822
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mfot04147]
    126489822
   04031 GTP-binding proteins [BR:mfot04031]
    126489822
Membrane trafficking [BR:mfot04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    126489822
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    126489822
  Macropinocytosis
   Ras GTPases
    126489822
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    126489822
Exosome [BR:mfot04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126489822
  Exosomal proteins of other body fluids (saliva and urine)
   126489822
  Exosomal proteins of colorectal cancer cells
   126489822
  Exosomal proteins of bladder cancer cells
   126489822
GTP-binding proteins [BR:mfot04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    126489822
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 126489822
NCBI-ProteinID: XP_049980344
LinkDB
Position
Unknown
AA seq 211 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGDTSGKDRTSRGRDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacctgcctgctg
atcagttacacgaccaatgcatttcctggagagtacatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaagccagtgaatctgggcttatgggatacagctgga
caagaagattatgacagattgcgtcccctctcctatccgcaaacagttggagacacaagt
ggtaaagatagaacctccaggggcagagacaagccgattgccgacgtgttcttaatttgc
ttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaagtg
cgacaccactgtcccaacactcccatcatcctagtggggacgaagcttgatcttagggat
gataaggacacgattgagaagctgaaggagaagaaactgacccccatcacctacccgcag
gggctagccatggcgaaagagatcggtgctgtcaaatatctggagtgctcagcactcaca
cagcgaggcctcaagacagtgtttgatgaagctatccgagctgttctctgtccacctcct
gtcaagaagaggaagagaaaatgcctgttgttgtaa

DBGET integrated database retrieval system