Alexandromys fortis (reed vole): 126490514 Help Entry 126490514         CDS       T08493                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mfot  Alexandromys fortis (reed vole) Brite KEGG Orthology (KO) [BR:mfot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mfot03041]     126490514   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mfot04052]     126490514 Spliceosome [BR:mfot03041]  Complex B   Other components    Complex B specific factors     126490514 Cytokines and neuropeptides [BR:mfot04052]  Neuropeptides   Unclassified    126490514 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  126490514 NCBI-ProteinID:  XP_049981436 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtttgtaacgaccgtctaggaaagaaagtccgcgtcaagtgcaacacc gatgacaccatcggggacttgaagaaactgatagcggctcaaactggcacccggtggaat aagatcgttcttaaaaagtggtacacgatttttaaggaccacgtgtctctgggagattat gaaatccatgatgggatgaacctggagctgtattaccaatag

DBGET integrated database retrieval system