Alexandromys fortis (reed vole): 126490718 Help Entry 126490718         CDS       T08493                                  Name (RefSeq) profilin-4   KO K05759   profilin Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04015   Rap1 signaling pathway mfot04810   Regulation of actin cytoskeleton mfot05014   Amyotrophic lateral sclerosis mfot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     126490718  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     126490718  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126490718   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     126490718  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfot04131]     126490718   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mfot04812]     126490718    04147 Exosome [BR:mfot04147]     126490718 Membrane trafficking [BR:mfot04131]  Others   Actin-binding proteins    Others     126490718 Cytoskeleton proteins [BR:mfot04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      126490718 Exosome [BR:mfot04147]  Exosomal proteins   Proteins found in most exosomes    126490718 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  126490718 NCBI-ProteinID:  XP_049981812 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPSDVRTLVNGFAKNPLITR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTAGMYPSVCVEATEKL GDYLRKKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtcacttacaaaacttactgttagacaccttgctggggacaaagcacgtggacagt gccgccctcatcaaactccaagaaaggagcctgtgtgtggcatcaccaggatttagtgta atgccaagtgatgttcgaacacttgtgaatggatttgccaaaaacccactgataacccga agggaaggcttgtacttcaaggaaaaggattacaaatgtgtccgggcggacgactattct ctttatgctaagaatgagaacactggtgtggttgttgtgaagacccatctgtatcttctg gtggccacttacactgcaggcatgtatcctagcgtctgtgtggaggccacagagaagctg ggagactatctaagaaagaaaggaagctaa

DBGET integrated database retrieval system