Alexandromys fortis (reed vole): 126492787 Help Entry 126492787         CDS       T08493                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04382   Cornified envelope formation mfot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mfot00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     126492787  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126492787  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfot04147]     126492787 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of microglial cells    126492787 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 Motif Other DBs NCBI-GeneID:  126492787 NCBI-ProteinID:  XP_049985323 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMLTFHRFAGDKDYLTKEDLRVLMEREFPGFLENQKDPMAVDKIMKDLD QCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccttctcagatggagcatgccatggaaaccatgatgctgacattccacagatttgca ggggacaaagactacttgacaaaggaggacctgagggtgctcatggaaagggagttccct ggatttttggaaaatcaaaaggaccccatggctgtggacaaaataatgaaggacctggac cagtgccgagacggcaaggtcggcttccagagctttctgtcactagttgcagggctcatc attgcgtgcaatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system