Alexandromys fortis (reed vole): 126494140 Help Entry 126494140         CDS       T08493                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04066   HIF-1 signaling pathway mfot04120   Ubiquitin mediated proteolysis mfot05170   Human immunodeficiency virus 1 infection mfot05200   Pathways in cancer mfot05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mfot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     126494140  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     126494140  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126494140   09162 Cancer: specific types    05211 Renal cell carcinoma     126494140   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     126494140  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mfot04121]     126494140    03400 DNA repair and recombination proteins [BR:mfot03400]     126494140 Ubiquitin system [BR:mfot04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      126494140    Cul5 complex      126494140 DNA repair and recombination proteins [BR:mfot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      126494140 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  126494140 NCBI-ProteinID:  XP_049987319 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIIESILKRPPAEQRLYKDDQLLDDGKTLEEC GFTSLTARPQAPATVGLAFREDDAFEALHIEPFSSPAERP NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttctcatgatccggcgccacaagacaaccatcttcacggatgccaaggag tcgagtaccgtattcgagctgaagcgcatcattgagagcatccttaagcggccaccagct gagcagcggctgtacaaggacgaccagctccttgatgatgggaaaactctggaggagtgt ggcttcactagcctgacagcacggccacaggccccagccacagtgggcctggccttccga gaggacgatgccttcgaagccctgcacattgagcccttctccagccctgcagagcgtcca tag

DBGET integrated database retrieval system