Alexandromys fortis (reed vole): 126494315 Help Entry 126494315         CDS       T08493                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04613   Neutrophil extracellular trap formation mfot05034   Alcoholism mfot05202   Transcriptional misregulation in cancer mfot05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mfot00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     126494315  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     126494315   09163 Immune disease    05322 Systemic lupus erythematosus     126494315   09165 Substance dependence    05034 Alcoholism     126494315  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mfot03036]     126494315   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfot04147]     126494315 Chromosome and associated proteins [BR:mfot03036]  Eukaryotic type   Nucleosome assembly factors    Histones     126494315 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126494315 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  126494315 NCBI-ProteinID:  XP_049987548 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREISQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGEKA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagaccgctagaaagtcgaccggggggaaagcgccccgcaagcag ctggccaccaaggcggcccgcaaaagcgcgccctctaccggcggggtgaagaagcctcac cgctacaggcccgggaccgtggccctgcgagagatccgtcgttaccagaaatcgactgag ctgctcatccggaagctgcctttccagaggttggtgagggagatctcccaggacttcaag accgacctgaggtttcagagtgcagccatcggtgcccttcaggaggccagtgaagcgtac ctggtggggttgtttgaagataccaatctgtgtgccatccacgccaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggggagaaagcttaa

DBGET integrated database retrieval system