Alexandromys fortis (reed vole): 126497948 Help Entry 126497948         CDS       T08493                                  Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot01522   Endocrine resistance mfot04010   MAPK signaling pathway mfot04012   ErbB signaling pathway mfot04024   cAMP signaling pathway mfot04137   Mitophagy - animal mfot04210   Apoptosis mfot04310   Wnt signaling pathway mfot04380   Osteoclast differentiation mfot04510   Focal adhesion mfot04530   Tight junction mfot04620   Toll-like receptor signaling pathway mfot04621   NOD-like receptor signaling pathway mfot04625   C-type lectin receptor signaling pathway mfot04657   IL-17 signaling pathway mfot04658   Th1 and Th2 cell differentiation mfot04659   Th17 cell differentiation mfot04660   T cell receptor signaling pathway mfot04662   B cell receptor signaling pathway mfot04668   TNF signaling pathway mfot04722   Neurotrophin signaling pathway mfot04912   GnRH signaling pathway mfot04915   Estrogen signaling pathway mfot04921   Oxytocin signaling pathway mfot04926   Relaxin signaling pathway mfot04932   Non-alcoholic fatty liver disease mfot04933   AGE-RAGE signaling pathway in diabetic complications mfot05030   Cocaine addiction mfot05031   Amphetamine addiction mfot05132   Salmonella infection mfot05133   Pertussis mfot05135   Yersinia infection mfot05140   Leishmaniasis mfot05142   Chagas disease mfot05161   Hepatitis B mfot05162   Measles mfot05166   Human T-cell leukemia virus 1 infection mfot05167   Kaposi sarcoma-associated herpesvirus infection mfot05169   Epstein-Barr virus infection mfot05170   Human immunodeficiency virus 1 infection mfot05171   Coronavirus disease - COVID-19 mfot05200   Pathways in cancer mfot05203   Viral carcinogenesis mfot05207   Chemical carcinogenesis - receptor activation mfot05208   Chemical carcinogenesis - reactive oxygen species mfot05210   Colorectal cancer mfot05211   Renal cell carcinoma mfot05224   Breast cancer mfot05231   Choline metabolism in cancer mfot05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mfot05321   Inflammatory bowel disease mfot05323   Rheumatoid arthritis mfot05417   Lipid and atherosclerosis mfot05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     126497948    04012 ErbB signaling pathway     126497948    04310 Wnt signaling pathway     126497948    04668 TNF signaling pathway     126497948    04024 cAMP signaling pathway     126497948  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     126497948   09143 Cell growth and death    04210 Apoptosis     126497948   09144 Cellular community - eukaryotes    04510 Focal adhesion     126497948    04530 Tight junction     126497948  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126497948    04621 NOD-like receptor signaling pathway     126497948    04625 C-type lectin receptor signaling pathway     126497948    04660 T cell receptor signaling pathway     126497948    04658 Th1 and Th2 cell differentiation     126497948    04659 Th17 cell differentiation     126497948    04657 IL-17 signaling pathway     126497948    04662 B cell receptor signaling pathway     126497948   09152 Endocrine system    04912 GnRH signaling pathway     126497948    04915 Estrogen signaling pathway     126497948    04921 Oxytocin signaling pathway     126497948    04926 Relaxin signaling pathway     126497948   09156 Nervous system    04722 Neurotrophin signaling pathway     126497948   09158 Development and regeneration    04380 Osteoclast differentiation     126497948  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126497948    05207 Chemical carcinogenesis - receptor activation     126497948    05208 Chemical carcinogenesis - reactive oxygen species     126497948    05203 Viral carcinogenesis     126497948    05231 Choline metabolism in cancer     126497948    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     126497948   09162 Cancer: specific types    05210 Colorectal cancer     126497948    05211 Renal cell carcinoma     126497948    05224 Breast cancer     126497948   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     126497948    05170 Human immunodeficiency virus 1 infection     126497948    05161 Hepatitis B     126497948    05171 Coronavirus disease - COVID-19     126497948    05162 Measles     126497948    05167 Kaposi sarcoma-associated herpesvirus infection     126497948    05169 Epstein-Barr virus infection     126497948   09171 Infectious disease: bacterial    05132 Salmonella infection     126497948    05135 Yersinia infection     126497948    05133 Pertussis     126497948   09174 Infectious disease: parasitic    05140 Leishmaniasis     126497948    05142 Chagas disease     126497948   09163 Immune disease    05323 Rheumatoid arthritis     126497948    05321 Inflammatory bowel disease     126497948   09165 Substance dependence    05030 Cocaine addiction     126497948    05031 Amphetamine addiction     126497948   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     126497948    05418 Fluid shear stress and atherosclerosis     126497948   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     126497948    04933 AGE-RAGE signaling pathway in diabetic complications     126497948   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     126497948  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mfot03000]     126497948 Transcription factors [BR:mfot03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     126497948 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_Maf bZIP_2 Rab11-FIP3 MIC19_MIC25 RIMB1_N ZapB PspA_IM30 Fib_alpha TFIIA DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  126497948 NCBI-ProteinID:  XP_049992181 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccctaagatcctgaaacagagcatgaccttg aacctggccgacccggtgggcaatctgaagccgcacctccgcgccaagaactcggacctc ctcacgtcgcccgacgttgggctgcttaagctggcgtcgcccgaactggagcgcctgatc atccagtccagcaatgggcacatcaccaccacgccgacccccacccagttcttgtgcccc aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcatagccagaacacgctgcccagcgtcacgtccgcggcacagccggtcagcggggcg ggcatggtggcccccgcggtggcatcggtagccggcgctggcggcggcggaggctacagc gccagcctgcacagcgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg ctgagcagcggcggcggggcgccctcctacggcgcggccgggctggcttttccgtcgcag ccccagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg cagcacccccggctgcaggccctgaaggaagagccgcagaccgtgcccgagatgccggga gagaccccgcccctgtcccccatcgacatggagtctcaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc gcccgactagaggaaaaagtgaaaaccttgaaagcgcaaaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccagctcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system