Alexandromys fortis (reed vole): 126498317 Help Entry 126498317         CDS       T08493                                  Name (RefSeq) cytochrome c, somatic-like   KO K08738   cytochrome c Organism mfot  Alexandromys fortis (reed vole) Pathway mfot00190   Oxidative phosphorylation mfot01100   Metabolic pathways mfot01524   Platinum drug resistance mfot04115   p53 signaling pathway mfot04210   Apoptosis mfot04215   Apoptosis - multiple species mfot04932   Non-alcoholic fatty liver disease mfot05010   Alzheimer disease mfot05012   Parkinson disease mfot05014   Amyotrophic lateral sclerosis mfot05016   Huntington disease mfot05017   Spinocerebellar ataxia mfot05020   Prion disease mfot05022   Pathways of neurodegeneration - multiple diseases mfot05132   Salmonella infection mfot05134   Legionellosis mfot05145   Toxoplasmosis mfot05152   Tuberculosis mfot05160   Hepatitis C mfot05161   Hepatitis B mfot05162   Measles mfot05163   Human cytomegalovirus infection mfot05164   Influenza A mfot05167   Kaposi sarcoma-associated herpesvirus infection mfot05168   Herpes simplex virus 1 infection mfot05169   Epstein-Barr virus infection mfot05170   Human immunodeficiency virus 1 infection mfot05200   Pathways in cancer mfot05210   Colorectal cancer mfot05222   Small cell lung cancer mfot05416   Viral myocarditis mfot05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     126498317  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     126498317    04215 Apoptosis - multiple species     126498317    04115 p53 signaling pathway     126498317  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126498317   09162 Cancer: specific types    05210 Colorectal cancer     126498317    05222 Small cell lung cancer     126498317   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     126498317    05161 Hepatitis B     126498317    05160 Hepatitis C     126498317    05164 Influenza A     126498317    05162 Measles     126498317    05168 Herpes simplex virus 1 infection     126498317    05163 Human cytomegalovirus infection     126498317    05167 Kaposi sarcoma-associated herpesvirus infection     126498317    05169 Epstein-Barr virus infection     126498317   09171 Infectious disease: bacterial    05132 Salmonella infection     126498317    05134 Legionellosis     126498317    05152 Tuberculosis     126498317   09174 Infectious disease: parasitic    05145 Toxoplasmosis     126498317   09164 Neurodegenerative disease    05010 Alzheimer disease     126498317    05012 Parkinson disease     126498317    05014 Amyotrophic lateral sclerosis     126498317    05016 Huntington disease     126498317    05017 Spinocerebellar ataxia     126498317    05020 Prion disease     126498317    05022 Pathways of neurodegeneration - multiple diseases     126498317   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     126498317    05416 Viral myocarditis     126498317   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     126498317   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     126498317 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  126498317 NCBI-ProteinID:  XP_049992809 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MGDVEKGKKSFVQKCAQCHTVEKGGKHKTGPNLSSLFGRKMGQVAGFSYTDANKNKGVTW GGDALIECLDNFKKYIPGTKMIFAGIKKKG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgggtgacgttgagaaaggcaagaagagttttgttcagaagtgtgcccagtgccacact gtggaaaagggaggcaagcataagactggaccaaatctcagcagtctgtttgggaggaag atgggtcaggtggctggattctcgtacacagatgccaacaagaacaaaggcgtcacctgg ggaggagatgccctgatagagtgtttggataatttcaaaaagtacatccctggaacaaaa atgatcttcgctggaattaagaagaagggatag

DBGET integrated database retrieval system