Alexandromys fortis (reed vole): 126499590 Help Entry 126499590         CDS       T08493                                  Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04024   cAMP signaling pathway mfot04062   Chemokine signaling pathway mfot04064   NF-kappa B signaling pathway mfot04210   Apoptosis mfot04380   Osteoclast differentiation mfot04620   Toll-like receptor signaling pathway mfot04621   NOD-like receptor signaling pathway mfot04622   RIG-I-like receptor signaling pathway mfot04623   Cytosolic DNA-sensing pathway mfot04625   C-type lectin receptor signaling pathway mfot04657   IL-17 signaling pathway mfot04658   Th1 and Th2 cell differentiation mfot04659   Th17 cell differentiation mfot04660   T cell receptor signaling pathway mfot04662   B cell receptor signaling pathway mfot04668   TNF signaling pathway mfot04722   Neurotrophin signaling pathway mfot04920   Adipocytokine signaling pathway mfot04926   Relaxin signaling pathway mfot04931   Insulin resistance mfot04936   Alcoholic liver disease mfot05132   Salmonella infection mfot05134   Legionellosis mfot05135   Yersinia infection mfot05140   Leishmaniasis mfot05142   Chagas disease mfot05145   Toxoplasmosis mfot05160   Hepatitis C mfot05161   Hepatitis B mfot05162   Measles mfot05163   Human cytomegalovirus infection mfot05164   Influenza A mfot05166   Human T-cell leukemia virus 1 infection mfot05167   Kaposi sarcoma-associated herpesvirus infection mfot05168   Herpes simplex virus 1 infection mfot05169   Epstein-Barr virus infection mfot05170   Human immunodeficiency virus 1 infection mfot05171   Coronavirus disease - COVID-19 mfot05200   Pathways in cancer mfot05203   Viral carcinogenesis mfot05208   Chemical carcinogenesis - reactive oxygen species mfot05215   Prostate cancer mfot05220   Chronic myeloid leukemia mfot05222   Small cell lung cancer mfot05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mfot05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     126499590    04668 TNF signaling pathway     126499590    04024 cAMP signaling pathway     126499590  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     126499590  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126499590    04621 NOD-like receptor signaling pathway     126499590    04622 RIG-I-like receptor signaling pathway     126499590    04623 Cytosolic DNA-sensing pathway     126499590    04625 C-type lectin receptor signaling pathway     126499590    04660 T cell receptor signaling pathway     126499590    04658 Th1 and Th2 cell differentiation     126499590    04659 Th17 cell differentiation     126499590    04657 IL-17 signaling pathway     126499590    04662 B cell receptor signaling pathway     126499590    04062 Chemokine signaling pathway     126499590   09152 Endocrine system    04920 Adipocytokine signaling pathway     126499590    04926 Relaxin signaling pathway     126499590   09156 Nervous system    04722 Neurotrophin signaling pathway     126499590   09158 Development and regeneration    04380 Osteoclast differentiation     126499590  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126499590    05208 Chemical carcinogenesis - reactive oxygen species     126499590    05203 Viral carcinogenesis     126499590    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     126499590   09162 Cancer: specific types    05220 Chronic myeloid leukemia     126499590    05215 Prostate cancer     126499590    05222 Small cell lung cancer     126499590   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     126499590    05170 Human immunodeficiency virus 1 infection     126499590    05161 Hepatitis B     126499590    05160 Hepatitis C     126499590    05171 Coronavirus disease - COVID-19     126499590    05164 Influenza A     126499590    05162 Measles     126499590    05168 Herpes simplex virus 1 infection     126499590    05163 Human cytomegalovirus infection     126499590    05167 Kaposi sarcoma-associated herpesvirus infection     126499590    05169 Epstein-Barr virus infection     126499590   09171 Infectious disease: bacterial    05132 Salmonella infection     126499590    05135 Yersinia infection     126499590    05134 Legionellosis     126499590   09174 Infectious disease: parasitic    05145 Toxoplasmosis     126499590    05140 Leishmaniasis     126499590    05142 Chagas disease     126499590   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     126499590   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     126499590    04931 Insulin resistance     126499590  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mfot03000]     126499590    04131 Membrane trafficking [BR:mfot04131]     126499590 Transcription factors [BR:mfot03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     126499590 Membrane trafficking [BR:mfot04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     126499590 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  126499590 NCBI-ProteinID:  XP_049994836 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPVGQGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAQ LAAEPWKQQLTEDGDSFLHLAIIHEEKTLTMEVIRQVKGDLAFLNFQNNLLQTPLHLAVI TNQPGIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCTPQHLHSILQATN YNGHTCLHLASIRGYLGIVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEDCYDTESEFTEDEL PYDDCVFGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcagccggtcggccaaggccaggactgggccatggagggcccgcgggacggcctc aagaaagagcggctggtggacgatcgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgcgagatccgcctgcagccgcaagaggcgcag ctagcagccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg gcaatcatccatgaagagaagactctgaccatggaagtgattcggcaggtgaagggagac ctcgccttcctcaacttccagaacaacctgctgcagactccacttcacttggctgtgatc accaaccagccaggaattgccgaggcacttttggaagctggctgtgatcctgagctccga gactttcgaggaaatacccctctacatcttgcctgtgagcagggctgcctggccagtgta ggagtcttaacgcagacttgcacaccccagcatctccactccatcctgcaggccaccaac tacaacggccacacgtgtctgcacctagcctccatccgcggctacctgggcatcgtggag catctggtgtctttgggcgcggatgtcaacgcgcaggagccctgcaatggccggacagcc ctccaccttgcggtggacctgcagaatcctgacctggtctcactcttgctgaagtgtggc gctgatgtcaacagagtcacctaccaaggctactccccctatcaactcacctggggccgc ccgagcacccggatacagcagcagctgggccagctgaccctggaaaaccttcagatgctg ccggagagcgaggatgaggattgctatgacacagagtccgagttcacggaggatgagctg ccctatgacgactgtgtgtttggaggccagcgtctgacgttgtga

DBGET integrated database retrieval system