Alexandromys fortis (reed vole): 126500456 Help Entry 126500456         CDS       T08493                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04613   Neutrophil extracellular trap formation mfot05034   Alcoholism mfot05202   Transcriptional misregulation in cancer mfot05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mfot00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     126500456  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     126500456   09163 Immune disease    05322 Systemic lupus erythematosus     126500456   09165 Substance dependence    05034 Alcoholism     126500456  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mfot03036]     126500456   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfot04147]     126500456 Chromosome and associated proteins [BR:mfot03036]  Eukaryotic type   Nucleosome assembly factors    Histones     126500456 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126500456 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  126500456 NCBI-ProteinID:  XP_049996337 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGEKA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagaccgctagaaagtcgaccggggggaaagcgccccgcaagcag ctggccaccaaggcggcccgcaaaagcgcgccctctaccggcggggtgaagaagcctcac cgctacaggcccgggaccgtggccctgcgagagatccgtcgctaccagaaatcgactgag ctgctcatccggaagctgcctttccagaggttggtgagggagatcgcccaggacttcaag accgacctgaggtttcagagtgcagccatcggtgcccttcaggaggccagtgaagcgtac ctggtggggttgtttgaagataccaatctgtgtgccatccacgccaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggggagaaagcttaa

DBGET integrated database retrieval system