Alexandromys fortis (reed vole): 126501831 Help Entry 126501831         CDS       T08493                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04613   Neutrophil extracellular trap formation mfot05034   Alcoholism mfot05203   Viral carcinogenesis mfot05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mfot00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     126501831  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     126501831   09163 Immune disease    05322 Systemic lupus erythematosus     126501831   09165 Substance dependence    05034 Alcoholism     126501831  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mfot03036]     126501831 Chromosome and associated proteins [BR:mfot03036]  Eukaryotic type   Nucleosome assembly factors    Histones     126501831 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  126501831 NCBI-ProteinID:  XP_049998644 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaaaggcctgggcaaaggcggcgccaagcgccaccgc aaggtcctgcgcgacaacatccagggcatcaccaagcccgccatccgccgcctggcccgg cgcggaggagtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctgaag gtgttcctggagaacgtgatccgcgacgcggtcacctacacggagcacgccaagcgcaag accgtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcggcggttaa

DBGET integrated database retrieval system