Alexandromys fortis (reed vole): 126502944 Help Entry 126502944         CDS       T08493                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mfot00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     126502944  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mfot03019]     126502944    03029 Mitochondrial biogenesis [BR:mfot03029]     126502944 Messenger RNA biogenesis [BR:mfot03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      126502944 Mitochondrial biogenesis [BR:mfot03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     126502944 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  126502944 NCBI-ProteinID:  XP_050000299 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCATDGSCSCAGSCKCKQCKCTTCKKSCCSCCPVGCAKCSQGCICKEASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgtgccacagatggatcctgctcctgcgccggctcttgcaaa tgcaaacagtgcaaatgcaccacctgcaagaaaagctgctgctcctgttgccccgtgggc tgtgcgaagtgctctcagggctgcatctgcaaagaagcttcggacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system