Alexandromys fortis (reed vole): 126504631 Help Entry 126504631         CDS       T08493                                  Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism mfot  Alexandromys fortis (reed vole) Brite KEGG Orthology (KO) [BR:mfot00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mfot01002]     126504631   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfot04147]     126504631 Peptidases and inhibitors [BR:mfot01002]  Peptidase inhibitors   Family I25: cystatin family    126504631 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    126504631 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Dynein_light PhosphMutase Motif Other DBs NCBI-GeneID:  126504631 NCBI-ProteinID:  XP_050003012 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MMCGAPSATQPATAETQEIADEVKSQLEEKENQKFSVFKAISFRRQVVAGINFFIKVDVG NDKFVHLRVFKALPHENKPLTLSSYQTNKEQHDELSFF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgtggagcgccatccgccacgcagccggccacagccgagacgcaggagatcgcc gacgaggtgaaatcccagcttgaagagaaagaaaatcagaagttctccgtctttaaagcc atatccttcaggcggcaggtggtggctggcattaacttctttatcaaggttgatgttggc aatgataaatttgtgcacttgagagtgttcaaagccctccctcatgaaaacaagcccctg accttgtcttcctaccagaccaacaaagagcaacacgatgagctgagcttcttctga

DBGET integrated database retrieval system