Alexandromys fortis (reed vole): 126506235 Help Entry 126506235         CDS       T08493                                  Name (RefSeq) tubulin alpha-1A chain-like   KO K07374   tubulin alpha Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04145   Phagosome mfot04210   Apoptosis mfot04517   IgSF CAM signaling mfot04530   Tight junction mfot04540   Gap junction mfot04814   Motor proteins mfot05010   Alzheimer disease mfot05012   Parkinson disease mfot05014   Amyotrophic lateral sclerosis mfot05016   Huntington disease mfot05020   Prion disease mfot05022   Pathways of neurodegeneration - multiple diseases mfot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     126506235  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126506235   09143 Cell growth and death    04210 Apoptosis     126506235   09144 Cellular community - eukaryotes    04530 Tight junction     126506235    04540 Gap junction     126506235   09142 Cell motility    04814 Motor proteins     126506235  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126506235   09164 Neurodegenerative disease    05010 Alzheimer disease     126506235    05012 Parkinson disease     126506235    05014 Amyotrophic lateral sclerosis     126506235    05016 Huntington disease     126506235    05020 Prion disease     126506235    05022 Pathways of neurodegeneration - multiple diseases     126506235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mfot03019]     126506235    03036 Chromosome and associated proteins [BR:mfot03036]     126506235   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mfot04812]     126506235    04147 Exosome [BR:mfot04147]     126506235 Messenger RNA biogenesis [BR:mfot03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      126506235 Chromosome and associated proteins [BR:mfot03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      126506235 Cytoskeleton proteins [BR:mfot04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     126506235 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126506235   Exosomal proteins of other body fluids (saliva and urine)    126506235   Exosomal proteins of colorectal cancer cells    126506235 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin Tubulin_3 Motif Other DBs NCBI-GeneID:  126506235 NCBI-ProteinID:  XP_050005573 LinkDB All DBs Position Unknown AA seq 262 aa AA seqDB search MESDNVGIFNPWGSFKDQRRXQPDGQMPSDKAIGGGDDSFNTFFSETGAGKHVPQAVFVD LEPTVIDEVRTGTYRQLFHPEQLITGKEDTANNYARGHYTIGKEIIDLVLDRIRKLADQC TGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSIL TTHTTLEHSDCAFMVDNEAIYDICRRNLDIKRPNYTNLLIGQIVSSITASLRFDGGLNVD QIRKSETTFNCSETQHSNVIVE NT seq 789 nt NT seq  +upstreamnt  +downstreamnt atggaaagtgacaacgtagggatcttcaacccctggggcagcttcaaagatcaaaggaga gnccagcctgacggccagatgccaagtgacaaggccattgggggaggagacgactccttc aacaccttcttcagtgagacaggagctggcaagcacgtgccccaggcagtgttcgtagac ctagagcccacggttattgatgaagttcgcactggtacctaccgccagctcttccaccct gagcagctcatcacaggcaaggaagatactgccaataactatgcccgtggccactacacc attggcaaggagatcatcgacctcgtcttggacagaattcgcaagctggccgaccagtgc acaggtcttcagggcttcttggtcttccacagctttggcgggggaactggctctgggttt acctccctgctgatggagaggctctctgttgattacggaaagaagtccaagctggagttc tccatctatccagccccccaggtttccaccgctgtggttgagccctacaactccatcctc accacccacaccaccctggagcactctgattgtgccttcatggtggacaacgaggccatc tatgacatctgtcgtaggaacctcgacattaagcgccccaactacaccaacctcctcatt ggccagattgtgtcctccatcactgcttccctcagatttgatggaggcctgaatgtcgac cagattagaaaatctgagacaacgtttaattgttcagaaacacagcattcaaatgtgatt gttgaatag

DBGET integrated database retrieval system