Alexandromys fortis (reed vole): 126506312 Help Entry 126506312         CDS       T08493                                  Name (RefSeq) C-X-C motif chemokine 11   KO K12672   C-X-C motif chemokine 11 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04060   Cytokine-cytokine receptor interaction mfot04061   Viral protein interaction with cytokine and cytokine receptor mfot04062   Chemokine signaling pathway mfot04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     126506312    04061 Viral protein interaction with cytokine and cytokine receptor     126506312  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126506312    04062 Chemokine signaling pathway     126506312  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mfot04052]     126506312 Cytokines and neuropeptides [BR:mfot04052]  Cytokines   Chemokines    126506312 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  126506312 NCBI-ProteinID:  XP_050005753 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MKGIATAFAVLICATAVQGFTMFRAGRCLCIDPGVKAVRKADIERVSVIYPTSGCNKVEV IVTLKANKGERCLNPKSKQARIIQQAMERKSSLKHQNHVKS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaagggcatcgccacagccttcgctgtgctaatctgtgctacagctgtccaaggcttc actatgttcagagcggggcgctgcctttgtatagaccccggagtgaaagccgtcaggaag gcagatatcgagagagtctccgtaatctacccgactagtggctgtaacaaagtcgaagtg attgttaccctgaaagccaataaaggagaaaggtgcctgaaccccaaatcaaagcaagca cgcatcatacaacaggcgatggaaagaaagagttctttaaagcaccaaaaccatgtgaag tcctaa

DBGET integrated database retrieval system