Alexandromys fortis (reed vole): 126506775 Help Entry 126506775         CDS       T08493                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04014   Ras signaling pathway mfot04015   Rap1 signaling pathway mfot04020   Calcium signaling pathway mfot04022   cGMP-PKG signaling pathway mfot04024   cAMP signaling pathway mfot04070   Phosphatidylinositol signaling system mfot04114   Oocyte meiosis mfot04218   Cellular senescence mfot04261   Adrenergic signaling in cardiomyocytes mfot04270   Vascular smooth muscle contraction mfot04371   Apelin signaling pathway mfot04625   C-type lectin receptor signaling pathway mfot04713   Circadian entrainment mfot04720   Long-term potentiation mfot04722   Neurotrophin signaling pathway mfot04728   Dopaminergic synapse mfot04740   Olfactory transduction mfot04744   Phototransduction mfot04750   Inflammatory mediator regulation of TRP channels mfot04910   Insulin signaling pathway mfot04912   GnRH signaling pathway mfot04915   Estrogen signaling pathway mfot04916   Melanogenesis mfot04921   Oxytocin signaling pathway mfot04922   Glucagon signaling pathway mfot04924   Renin secretion mfot04925   Aldosterone synthesis and secretion mfot04970   Salivary secretion mfot04971   Gastric acid secretion mfot05010   Alzheimer disease mfot05012   Parkinson disease mfot05022   Pathways of neurodegeneration - multiple diseases mfot05031   Amphetamine addiction mfot05034   Alcoholism mfot05133   Pertussis mfot05152   Tuberculosis mfot05163   Human cytomegalovirus infection mfot05167   Kaposi sarcoma-associated herpesvirus infection mfot05170   Human immunodeficiency virus 1 infection mfot05200   Pathways in cancer mfot05214   Glioma mfot05417   Lipid and atherosclerosis mfot05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     126506775    04015 Rap1 signaling pathway     126506775    04371 Apelin signaling pathway     126506775    04020 Calcium signaling pathway     126506775    04070 Phosphatidylinositol signaling system     126506775    04024 cAMP signaling pathway     126506775    04022 cGMP-PKG signaling pathway     126506775  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     126506775    04218 Cellular senescence     126506775  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     126506775   09152 Endocrine system    04910 Insulin signaling pathway     126506775    04922 Glucagon signaling pathway     126506775    04912 GnRH signaling pathway     126506775    04915 Estrogen signaling pathway     126506775    04921 Oxytocin signaling pathway     126506775    04916 Melanogenesis     126506775    04924 Renin secretion     126506775    04925 Aldosterone synthesis and secretion     126506775   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     126506775    04270 Vascular smooth muscle contraction     126506775   09154 Digestive system    04970 Salivary secretion     126506775    04971 Gastric acid secretion     126506775   09156 Nervous system    04728 Dopaminergic synapse     126506775    04720 Long-term potentiation     126506775    04722 Neurotrophin signaling pathway     126506775   09157 Sensory system    04744 Phototransduction     126506775    04740 Olfactory transduction     126506775    04750 Inflammatory mediator regulation of TRP channels     126506775   09159 Environmental adaptation    04713 Circadian entrainment     126506775  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126506775   09162 Cancer: specific types    05214 Glioma     126506775   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     126506775    05163 Human cytomegalovirus infection     126506775    05167 Kaposi sarcoma-associated herpesvirus infection     126506775   09171 Infectious disease: bacterial    05133 Pertussis     126506775    05152 Tuberculosis     126506775   09164 Neurodegenerative disease    05010 Alzheimer disease     126506775    05012 Parkinson disease     126506775    05022 Pathways of neurodegeneration - multiple diseases     126506775   09165 Substance dependence    05031 Amphetamine addiction     126506775    05034 Alcoholism     126506775   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     126506775    05418 Fluid shear stress and atherosclerosis     126506775  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mfot01009]     126506775   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfot04131]     126506775    03036 Chromosome and associated proteins [BR:mfot03036]     126506775   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfot04147]     126506775 Protein phosphatases and associated proteins [BR:mfot01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      126506775 Membrane trafficking [BR:mfot04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     126506775 Chromosome and associated proteins [BR:mfot03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      126506775 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    126506775 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 Allatotropin-like_C EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 EF_SSP120 EFhand_Ca_insen BamM_C EF-hand_EFHB_C SAPC2_N DUF5580_M EF-hand_11 Dockerin_1 EF-hand_STIM1 Caleosin FCaBP_EF-hand DUF1103 SurA_N_3 RFC1 EF-hand_SWAP70_N Motif Other DBs NCBI-GeneID:  126506775 NCBI-ProteinID:  XP_050006529 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MTNQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQGMVNEIDKDG NGTVDFPEFLSMMSRKMKDTDSEEEIREAFRVFDKDGNGYVSAAELRHVMTRLGEKLSDE EVEEMIRAADTDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccagctgactgaggagcaaatcgctgagttcaaggaggccttctctctgttt gacaaggatggggacggctgcatcaccacccaggaactgggcactgtcatgcggtccctg ggtcagaaccccacggaggctgagctccagggcatggtgaatgaaattgacaaggatgga aacggcactgtagacttcccggagttcctgagcatgatgtccaggaagatgaaagacacc gacagcgaggaggagatccgggaggccttccgggtgttcgacaaggatggcaacggctat gtcagtgctgctgagctgaggcatgtgatgaccaggctgggggagaagctgagtgacgag gaggtggaggaaatgatacgggcagcagatacagatggcgatgggcaagtgaactatgag gagtttgtccacatgctcgtatccaagtga

DBGET integrated database retrieval system