Alexandromys fortis (reed vole): 126506891 Help Entry 126506891         CDS       T08493                                  Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mfot  Alexandromys fortis (reed vole) Pathway mfot01521   EGFR tyrosine kinase inhibitor resistance mfot01524   Platinum drug resistance mfot04014   Ras signaling pathway mfot04064   NF-kappa B signaling pathway mfot04115   p53 signaling pathway mfot04137   Mitophagy - animal mfot04140   Autophagy - animal mfot04151   PI3K-Akt signaling pathway mfot04210   Apoptosis mfot04215   Apoptosis - multiple species mfot04621   NOD-like receptor signaling pathway mfot04630   JAK-STAT signaling pathway mfot05012   Parkinson disease mfot05014   Amyotrophic lateral sclerosis mfot05022   Pathways of neurodegeneration - multiple diseases mfot05145   Toxoplasmosis mfot05162   Measles mfot05166   Human T-cell leukemia virus 1 infection mfot05168   Herpes simplex virus 1 infection mfot05170   Human immunodeficiency virus 1 infection mfot05200   Pathways in cancer mfot05202   Transcriptional misregulation in cancer mfot05212   Pancreatic cancer mfot05220   Chronic myeloid leukemia mfot05222   Small cell lung cancer mfot05225   Hepatocellular carcinoma mfot05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     126506891    04630 JAK-STAT signaling pathway     126506891    04064 NF-kappa B signaling pathway     126506891    04151 PI3K-Akt signaling pathway     126506891  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     126506891    04137 Mitophagy - animal     126506891   09143 Cell growth and death    04210 Apoptosis     126506891    04215 Apoptosis - multiple species     126506891    04115 p53 signaling pathway     126506891  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     126506891  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126506891    05202 Transcriptional misregulation in cancer     126506891   09162 Cancer: specific types    05212 Pancreatic cancer     126506891    05225 Hepatocellular carcinoma     126506891    05220 Chronic myeloid leukemia     126506891    05222 Small cell lung cancer     126506891   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     126506891    05170 Human immunodeficiency virus 1 infection     126506891    05162 Measles     126506891    05168 Herpes simplex virus 1 infection     126506891   09174 Infectious disease: parasitic    05145 Toxoplasmosis     126506891   09164 Neurodegenerative disease    05012 Parkinson disease     126506891    05014 Amyotrophic lateral sclerosis     126506891    05022 Pathways of neurodegeneration - multiple diseases     126506891   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     126506891   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     126506891    01524 Platinum drug resistance     126506891  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mfot01009]     126506891   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mfot03036]     126506891   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mfot02000]     126506891 Protein phosphatases and associated proteins [BR:mfot01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      126506891 Chromosome and associated proteins [BR:mfot03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     126506891 Transporters [BR:mfot02000]  Other transporters   Pores ion channels [TC:1]    126506891 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  126506891 NCBI-ProteinID:  XP_050006801 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGPESERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaag ggatacagctggagtcagtttagtgatgtcgaagagaacaggactgaggccccagaagga cctgaatcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg gatagccccgcggtaaatggagccactggccacagcagcagtttggacgcccgggaggtg atccccatggcagcagtgaagcaagcgctaagagaggctggcgatgagtttgaactgcgg taccggcgggcgttcagtgatctaacatcgcagcttcatataaccccagggacagcatat caaagctttgagcaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatc gtggcctttttctccttcggtggagccctgtgtgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaagttggatggccacctatctgaatgaccacctagagcct tggatccaggacaacggcggctgggacacttttgtggaactctacgggaacaacgcagca gctgagagccggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctactgggctcgctcttcagtcggaagtga

DBGET integrated database retrieval system