Alexandromys fortis (reed vole): 126507079 Help Entry 126507079         CDS       T08493                                  Name (RefSeq) kunitz-type protease inhibitor 3   KO K23422   Kunitz-type protease inhibitor 3 Organism mfot  Alexandromys fortis (reed vole) Brite KEGG Orthology (KO) [BR:mfot00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mfot01002]     126507079 Peptidases and inhibitors [BR:mfot01002]  Peptidase inhibitors   Family I2: Kunitz - BPTI family    126507079 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Kunitz_BPTI Motif Other DBs NCBI-GeneID:  126507079 NCBI-ProteinID:  XP_050007198 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MRLQASFSVFLILAFCQELCSEPSKVFRKPFPELCKLPMERGECQTMQLRWHYNIKSGKC ERFSYGGCGGNENNFLTRNQCRLACRRS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcggctccaggcctccttctcggttttcctgatcctcgccttctgccaagagctttgc tcagaaccaagtaaagtattcagaaagcccttcccagagctatgcaaactccctatggaa aggggtgagtgtcaaaccatgcaactgcgatggcactataacatcaaatccggcaagtgt gagcggtttagctacggaggctgtggaggcaacgaaaacaactttctgaccagaaatcag tgccgcttagcctgcagacgttcctga

DBGET integrated database retrieval system