Alexandromys fortis (reed vole): 126508779 Help Entry 126508779         CDS       T08493                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04014   Ras signaling pathway mfot04015   Rap1 signaling pathway mfot04022   cGMP-PKG signaling pathway mfot04024   cAMP signaling pathway mfot04062   Chemokine signaling pathway mfot04071   Sphingolipid signaling pathway mfot04072   Phospholipase D signaling pathway mfot04144   Endocytosis mfot04150   mTOR signaling pathway mfot04270   Vascular smooth muscle contraction mfot04310   Wnt signaling pathway mfot04350   TGF-beta signaling pathway mfot04360   Axon guidance mfot04510   Focal adhesion mfot04520   Adherens junction mfot04530   Tight junction mfot04611   Platelet activation mfot04621   NOD-like receptor signaling pathway mfot04625   C-type lectin receptor signaling pathway mfot04660   T cell receptor signaling pathway mfot04670   Leukocyte transendothelial migration mfot04722   Neurotrophin signaling pathway mfot04810   Regulation of actin cytoskeleton mfot04921   Oxytocin signaling pathway mfot04928   Parathyroid hormone synthesis, secretion and action mfot04972   Pancreatic secretion mfot05100   Bacterial invasion of epithelial cells mfot05132   Salmonella infection mfot05133   Pertussis mfot05135   Yersinia infection mfot05152   Tuberculosis mfot05163   Human cytomegalovirus infection mfot05200   Pathways in cancer mfot05203   Viral carcinogenesis mfot05205   Proteoglycans in cancer mfot05206   MicroRNAs in cancer mfot05210   Colorectal cancer mfot05417   Lipid and atherosclerosis mfot05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     126508779    04015 Rap1 signaling pathway     126508779    04310 Wnt signaling pathway     126508779    04350 TGF-beta signaling pathway     126508779    04072 Phospholipase D signaling pathway     126508779    04071 Sphingolipid signaling pathway     126508779    04024 cAMP signaling pathway     126508779    04022 cGMP-PKG signaling pathway     126508779    04150 mTOR signaling pathway     126508779  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     126508779   09144 Cellular community - eukaryotes    04510 Focal adhesion     126508779    04520 Adherens junction     126508779    04530 Tight junction     126508779   09142 Cell motility    04810 Regulation of actin cytoskeleton     126508779  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     126508779    04621 NOD-like receptor signaling pathway     126508779    04625 C-type lectin receptor signaling pathway     126508779    04660 T cell receptor signaling pathway     126508779    04670 Leukocyte transendothelial migration     126508779    04062 Chemokine signaling pathway     126508779   09152 Endocrine system    04921 Oxytocin signaling pathway     126508779    04928 Parathyroid hormone synthesis, secretion and action     126508779   09153 Circulatory system    04270 Vascular smooth muscle contraction     126508779   09154 Digestive system    04972 Pancreatic secretion     126508779   09156 Nervous system    04722 Neurotrophin signaling pathway     126508779   09158 Development and regeneration    04360 Axon guidance     126508779  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126508779    05206 MicroRNAs in cancer     126508779    05205 Proteoglycans in cancer     126508779    05203 Viral carcinogenesis     126508779   09162 Cancer: specific types    05210 Colorectal cancer     126508779   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     126508779   09171 Infectious disease: bacterial    05132 Salmonella infection     126508779    05135 Yersinia infection     126508779    05133 Pertussis     126508779    05152 Tuberculosis     126508779    05100 Bacterial invasion of epithelial cells     126508779   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     126508779    05418 Fluid shear stress and atherosclerosis     126508779  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfot04131]     126508779   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfot04147]     126508779    04031 GTP-binding proteins [BR:mfot04031]     126508779 Membrane trafficking [BR:mfot04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     126508779 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126508779   Exosomal proteins of other body fluids (saliva and urine)    126508779   Exosomal proteins of colorectal cancer cells    126508779   Exosomal proteins of bladder cancer cells    126508779 GTP-binding proteins [BR:mfot04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     126508779 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  126508779 NCBI-ProteinID:  XP_050010149 LinkDB All DBs Position Unknown AA seq 252 aa AA seqDB search MAAIRKKLVIVGDGACGKKCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTRDGVREVFEMATRVLWH TAEANIRKLRAHCSEDGNILKTCTTAKVLKALSTASAQHGNSQKWTLSGFARTHRAETAN VPFPGDADKAGV NT seq 759 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcagaaagaaactggtgattgttggtgatggagcttgtggtaagaagtgc ttgctcatagtcttcagcaaggaccaattcccagaggtttatgtgcccacggtgtttgaa aactatgtggcagatattgaagtggatgggaagcaggtagagttggctttgtgggacaca gctggacaggaagattatgatcgcctgaggcctctctcctacccagacacggatgttata ctgatgtgcttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccagaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggaattagccaaaatgaagcaggagccggtaaaa cctgaagaaggcagagatatggcaaacagaattggtgcttttgggtacatggagtgttca gcaaagaccagagatggagtgagagaggtttttgaaatggccacgagagtgctgtggcac acagcggaggctaacatcagaaaactgcgagctcactgctcagaagacggcaacattctg aaaacttgcactactgcaaaggttctcaaagcgttatccacagcatcggcacagcacggg aacagtcagaaatggaccctctcaggcttcgctcgaacacacagagcagaaactgccaat gtgcccttcccgggagatgctgacaaagctggagtttaa

DBGET integrated database retrieval system