Alexandromys fortis (reed vole): 126510210 Help Entry 126510210         CDS       T08493                                  Name (RefSeq) gastrin   KO K13768   gastrin Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04081   Hormone signaling mfot04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     126510210  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     126510210  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mfot04052]     126510210 Cytokines and neuropeptides [BR:mfot04052]  Neuropeptides   GPCR binding    126510210 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  126510210 NCBI-ProteinID:  XP_050012613 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MFRLCVCMLILVLALATFSEASWKPHPHLQDASSGPGANGGLEPHQLDQLDPASHHRRQL GPQGPQHFITDLSKKQMPRMEEEEEAYGWMDFGRRSAEEGDQRN NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgtttcgactgtgcgtgtgcatgctgatcttagtgctggctctggctaccttctctgaa gcttcttggaagccccacccccatctacaggatgcatcctctggaccaggggccaacggg ggcctggaaccacaccagctggaccagctggacccagcctctcaccatcgaaggcagctg gggccccagggtcctcaacacttcataacagacctgtccaagaagcagatgccaaggatg gaggaagaagaagaggcctatggatggatggactttggccgccgcagtgctgaggaaggg gaccagcgcaactag

DBGET integrated database retrieval system