KEGG   Alexandromys fortis (reed vole): 126510984
Entry
126510984         CDS       T08493                                 
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
mfot  Alexandromys fortis (reed vole)
Pathway
mfot03083  Polycomb repressive complex
mfot04110  Cell cycle
mfot04114  Oocyte meiosis
mfot04120  Ubiquitin mediated proteolysis
mfot04141  Protein processing in endoplasmic reticulum
mfot04310  Wnt signaling pathway
mfot04350  TGF-beta signaling pathway
mfot04710  Circadian rhythm
mfot05132  Salmonella infection
mfot05170  Human immunodeficiency virus 1 infection
mfot05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mfot00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    126510984
   04120 Ubiquitin mediated proteolysis
    126510984
  09126 Chromosome
   03083 Polycomb repressive complex
    126510984
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    126510984
   04350 TGF-beta signaling pathway
    126510984
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    126510984
   04114 Oocyte meiosis
    126510984
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    126510984
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126510984
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    126510984
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    126510984
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mfot04131]
    126510984
   04121 Ubiquitin system [BR:mfot04121]
    126510984
   03036 Chromosome and associated proteins [BR:mfot03036]
    126510984
Membrane trafficking [BR:mfot04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    126510984
Ubiquitin system [BR:mfot04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     126510984
   Cul7 complex
     126510984
Chromosome and associated proteins [BR:mfot03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     126510984
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     126510984
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 126510984
NCBI-ProteinID: XP_050013759
LinkDB
Position
Unknown
AA seq 163 aa
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccttcgataaagttgcagagttctgatggagagatatttgaagttgatgtagaaatt
gccaaacaatctgtgactatcaagaccatgctggaagatttgggaatggatgatgaggga
gatgatgatcctgttcctttaccaaatgttaatgcagcaattctaaaaaaggtcattcag
tggtgcacccatcacaaggatgaccctcctcctcctgaggatgatgagaacaaagaaaag
cggacagatgatattcctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
ttcgaacttattctggctgcaaactacttagacatcaaaggtttgcttgatgtcacatgc
aagactgtggccaatatgattaaggggaaaactcctgaggagattcgtaaaaccttcaat
atcaaaaatgactttactgaagaggaagaggcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system