Alexandromys fortis (reed vole): 126512278 Help Entry 126512278         CDS       T08493                                  Name (RefSeq) somatostatin   KO K05237   somatostatin Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04024   cAMP signaling pathway mfot04080   Neuroactive ligand-receptor interaction mfot04081   Hormone signaling mfot04935   Growth hormone synthesis, secretion and action mfot04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     126512278   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     126512278    04081 Hormone signaling     126512278  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     126512278   09154 Digestive system    04971 Gastric acid secretion     126512278  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mfot04052]     126512278 Cytokines and neuropeptides [BR:mfot04052]  Neuropeptides   GPCR binding    126512278 SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  126512278 NCBI-ProteinID:  XP_050015916 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDAMEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcactggccgcgctctgcatcgtcctggccttgggc ggtgtcaccggcgccccctcggacccccgactccgtcagtttctgcagaagtctctggcc gctgccgcaggaaaacaggaactggccaagtacttcttggcagagctgctgtccgagccc aaccagacagagaatgatgccatggagcccgaggacttgccccaggcagcggagcaggat gaaatgaggctggagctgcagaggtctgccaactcgaacccagccatggcaccccgggaa cgcaaggcgggctgcaagaacttcttctggaagaccttcacatcctgctag

DBGET integrated database retrieval system