Alexandromys fortis (reed vole): 126512719 Help Entry 126512719         CDS       T08493                                  Name (RefSeq) ADP-ribosylation factor 3-like   KO K07937   ADP-ribosylation factor 1/2 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04072   Phospholipase D signaling pathway mfot04144   Endocytosis mfot05132   Salmonella infection mfot05134   Legionellosis Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     126512719  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     126512719  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126512719    05134 Legionellosis     126512719  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfot04131]     126512719   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfot04147]     126512719    04031 GTP-binding proteins [BR:mfot04031]     126512719 Membrane trafficking [BR:mfot04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     126512719   Arf GTPases and associated proteins    Arf GTPases     126512719  Endosome - Golgi transport     126512719 Exosome [BR:mfot04147]  Exosomal proteins   Proteins found in most exosomes    126512719 GTP-binding proteins [BR:mfot04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     126512719 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Motif Other DBs NCBI-GeneID:  126512719 NCBI-ProteinID:  XP_050016595 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MHILMVGLDAASRTTVLNKLKLGEILTTIPTIGFQRGDSEYKNISFTMWDVDDQDKIQPL WHHYFQYTQGLIPLVDSNDRERVNEDCEELMRRLAEIELWDAVLLVFANKQDLPNATNAT EITGKLGLHSLRHRNWYIQATCATSGDGLYD NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgcacattctcatggtgggcctggatgctgcctcgaggacaacagttctaaacaaactg aagctgggtgaaattctaaccaccattcccaccattgggtttcaacgtggagacagtgag tacaagaatatcagcttcaccatgtgggatgtggacgaccaggacaagatccagccactg tggcaccactacttccagtacacccaaggcttgatccccctagtggacagcaatgacaga gagcgtgtgaatgaggactgtgaagagctcatgaggaggctagctgaaatcgagctctgg gatgccgttctcttggtgtttgccaacaagcaggacctccccaatgccacgaatgcgact gaaatcacaggcaagctggggctgcactctctacgccacaggaactggtacattcaggcc acctgtgccaccagcggggacgggctctatgactga

DBGET integrated database retrieval system