Alexandromys fortis (reed vole): 126512808 Help Entry 126512808         CDS       T08493                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04613   Neutrophil extracellular trap formation mfot05034   Alcoholism mfot05202   Transcriptional misregulation in cancer mfot05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mfot00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     126512808  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     126512808   09163 Immune disease    05322 Systemic lupus erythematosus     126512808   09165 Substance dependence    05034 Alcoholism     126512808  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mfot03036]     126512808   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfot04147]     126512808 Chromosome and associated proteins [BR:mfot03036]  Eukaryotic type   Nucleosome assembly factors    Histones     126512808 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126512808 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-T_C Motif Other DBs NCBI-GeneID:  126512808 NCBI-ProteinID:  XP_050016719 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKANRKSAPSIGGVKKPNLYKPGTVALREIRRYQKSTD RSFFLLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEVYLVGPFEDTKLCVIHAK RVTIMPKDIQLARHICEERA NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgtaaatccaccggtggtaaagcgcccaggaaacaa ctggctacaaaagccaatcgcaagagtgcgccctctattggaggggtgaagaaacctaat ctttacaagcctggtactgtggcgctccgtgaaatcagacgctatcagaaatccactgat cgttcgttttttcttctgatccgcaaactccccttccagcgtctggtgcgagaaattgct caggacttcaaaacagatctgcgcttccagagtgcagctattggtgctttgcaggaggca agcgaggtctatctggttggcccttttgaagataccaagctgtgtgttatccatgccaaa cgtgtaacaattatgccaaaagatatccagctagcacgccacatatgcgaagaacgtgct taa

DBGET integrated database retrieval system