Alexandromys fortis (reed vole): 126515618 Help Entry 126515618         CDS       T08493                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04137   Mitophagy - animal mfot04140   Autophagy - animal mfot04144   Endocytosis mfot04145   Phagosome mfot04148   Efferocytosis mfot05132   Salmonella infection mfot05146   Amoebiasis mfot05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mfot00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     126515618    04145 Phagosome     126515618    04140 Autophagy - animal     126515618    04137 Mitophagy - animal     126515618    04148 Efferocytosis     126515618  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126515618    05152 Tuberculosis     126515618   09174 Infectious disease: parasitic    05146 Amoebiasis     126515618  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfot04131]     126515618   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfot04147]     126515618    04031 GTP-binding proteins [BR:mfot04031]     126515618 Membrane trafficking [BR:mfot04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     126515618 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126515618   Exosomal proteins of other body fluids (saliva and urine)    126515618   Exosomal proteins of colorectal cancer cells    126515618   Exosomal proteins of bladder cancer cells    126515618 GTP-binding proteins [BR:mfot04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     126515618 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  126515618 NCBI-ProteinID:  XP_050021395 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggtcatcatcctgggagattctggtgttgga aagacatcgctcatgaaccagtatgtaaataagaagttcagtaaccagtacaaagccaca ataggagcagactttctgaccaaggaggtgatggtggatgacagacttgtcaccatgcag atctgggacacagctggtcaagaacggttccagtctcttggtgtggccttctacagaggt gcagattgctgtgttctggtgtttgatgtgactgcccccaacacattcaaaacccttgac agctggagagacgagttccttattcaggccagcccccgggatccagagaacttccccttt gttgtgttgggaaacaagattgaccttgaaaacagacaagtggccacgaagagggcacag gcttggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggctatc aatgtggagcaggccttccagacaattgctcggaatgcccttaaacaggaaacagaagtg gagttatacaatgaattccctgaacccatcaaactggataagaatgaccgggccaaggcc tccgcagagagctgcagctgttga

DBGET integrated database retrieval system