Alexandromys fortis (reed vole): 126515894 Help Entry 126515894         CDS       T08493                                  Name (RefSeq) myosin regulatory light chain 11   KO K12758   fast skeletal myosin light chain 2 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04510   Focal adhesion mfot04520   Adherens junction mfot04670   Leukocyte transendothelial migration mfot04810   Regulation of actin cytoskeleton mfot04814   Motor proteins mfot04820   Cytoskeleton in muscle cells mfot05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mfot00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     126515894    04520 Adherens junction     126515894   09142 Cell motility    04814 Motor proteins     126515894    04820 Cytoskeleton in muscle cells     126515894    04810 Regulation of actin cytoskeleton     126515894  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     126515894  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126515894  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mfot04812]     126515894    04147 Exosome [BR:mfot04147]     126515894 Cytoskeleton proteins [BR:mfot04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      126515894 Exosome [BR:mfot04147]  Exosomal proteins   Exosomal proteins of hepatic cells    126515894 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Motif Other DBs NCBI-GeneID:  126515894 NCBI-ProteinID:  XP_050021863 LinkDB All DBs Position Unknown AA seq 169 aa AA seqDB search MAPKKAKRRAAAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKQFL EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagaaggccaagagaagggcagcagcagaagggagctccaatgtcttctcc atgttcgaccagactcagatccaggagttcaaggaggcttttactgtaattgaccagaac cgagatggcattatcgacaaggaggatctccgggacacctttgcagccatgggccgtctc aatgtgaagaatgaggaactcgacgccatgatgaaggaagccagtgggcccatcaacttc accgtcttcctgaccatgtttggggagaagctgaagggtgcggaccctgaggatgtaatc accggagccttcaaggtcctggacccagagggcaagggcaccatcaaaaagcagttcctg gaggagttgctcaccacacagtgtgacagattttcccaggaggagatcaagaacatgtgg gcagctttccctccagatgtgggcggcaacgtagactacaagaacatctgctatgtcatc acacacggtgacgctaaggaccaggaatag

DBGET integrated database retrieval system