Mesomycoplasma flocculare: MYF_00340 Help Entry MYF_00340         CDS       T03538                                  Symbol himA Name (GenBank) nucleoid DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism mfq  Mesomycoplasma flocculare Brite KEGG Orthology (KO) [BR:mfq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mfq03032]     MYF_00340 (himA)    03036 Chromosome and associated proteins [BR:mfq03036]     MYF_00340 (himA)    03400 DNA repair and recombination proteins [BR:mfq03400]     MYF_00340 (himA) DNA replication proteins [BR:mfq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     MYF_00340 (himA) Chromosome and associated proteins [BR:mfq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     MYF_00340 (himA) DNA repair and recombination proteins [BR:mfq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       MYF_00340 (himA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg HU-CCDC81_bac_2 TraI_2 Motif Other DBs NCBI-ProteinID:  AJC49648 UniProt:  A0A0A8E6N2 LinkDB All DBs Position 79996..80268 Genome browser AA seq 90 aa AA seqDB search MNKKELIDQIANETGLPTKNVELVLNQFFGITAEVVKKQGKLVINSFGTFQGVFKPASSS FNPLTKTQITVNAKTTIRFKPSKVLKDFIA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaaaagaattaattgatcaaattgctaacgaaacaggtttgccaactaaaaat gttgaacttgtcttgaatcaatttttcgggataacagctgaagttgtaaaaaaacaaggg aaattagttattaactcttttggaactttccaaggtgttttcaaaccagcttcttcttca tttaacccacttacaaaaacacaaattacagtaaatgctaaaacaacaattagatttaaa ccttcaaaagtcctaaaagattttattgcctaa

DBGET integrated database retrieval system